KEGG   Mus musculus (mouse): 20595Help
Entry
20595             CDS       T01002                                 

Gene name
Smn1, AI849087, Gemin1, Smn
Definition
(RefSeq) survival motor neuron 1
  KO
K13129  survival motor neuron protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Module
mmu_M00426  Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    20595 (Smn1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    20595 (Smn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SMN TUDOR
Motif
Other DBs
NCBI-GeneID: 20595
NCBI-ProteinID: NP_035550
MGI: 109257
Ensembl: ENSMUSG00000021645
Vega: OTTMUSG00000033496
UniProt: P97801 Q549F9
Position
13 D1; 13 52.99 cM
AA seq 288 aa AA seqDB search
MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETP
DKPKGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVWSEDGCIYPATITSIDFKRETC
VVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQENESQVSTDDSEHSSRSLRSKAHSKS
KAAPWTSFLPPPPPMPGSGLGPGKPGLKFNGPPPPPPLPPPPFLPCWMPPFPSGPPIIPP
PPPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKKEGKCSHTN
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgggcagtggcggagcgggctccgagcaggaagatacggtgctgttccggcgt
ggcaccggccagagtgatgattctgacatttgggatgatacagcattgataaaagcttat
gataaagctgtggcttcctttaagcatgctctaaagaacggtgacatttgtgaaactcca
gataagccaaaaggcacagccagaagaaaacctgccaagaagaataaaagccaaaagaag
aatgccacaactcccttgaaacagtggaaagttggtgacaagtgttctgctgtttggtca
gaagacggctgcatttacccagctactattacgtccattgactttaagagagaaacctgt
gtcgtggtttatactggatatggaaacagagaggagcaaaacttatctgacctactttcc
ccgacctgtgaagtagctaatagtacagaacagaacactcaggagaatgaaagtcaagtt
tccacagacgacagtgaacactcctccagatcgctcagaagtaaagcacacagcaagtcc
aaagctgctccgtggacctcatttcttcctccaccacccccaatgccagggtcaggatta
ggaccaggaaagccaggtctaaaattcaacggcccgccgccgccgcctccactaccccct
ccccccttcctgccgtgctggatgcccccgttcccttcaggaccaccaataatcccgcca
ccccctcccatctctcccgactgtctggatgacactgatgccctgggcagtatgctaatc
tcttggtacatgagtggctaccacactggctactatatgggtttcagacaaaataaaaaa
gaaggaaagtgctcacatacaaattaa

DBGET integrated database retrieval system