KEGG   Mus musculus (mouse): 20595Help
Entry
20595             CDS       T01002                                 

Gene name
Smn1, AI849087, Gemin1, Smn
Definition
(RefSeq) survival motor neuron 1
  KO
K13129  
survival motor neuron protein
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    20595 (Smn1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    20595 (Smn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 52.99 cM; 13 D1/D2.1
AA seq 288 aa AA seqDB search
MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETP
DKPKGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVWSEDGCIYPATITSIDFKRETC
VVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQENESQVSTDDSEHSSRSLRSKAHSKS
KAAPWTSFLPPPPPMPGSGLGPGKPGLKFNGPPPPPPLPPPPFLPCWMPPFPSGPPIIPP
PPPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKKEGKCSHTN
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgggcagtggcggagcgggctccgagcaggaagatacggtgctgttccggcgt
ggcaccggccagagtgatgattctgacatttgggatgatacagcattgataaaagcttat
gataaagctgtggcttcctttaagcatgctctaaagaacggtgacatttgtgaaactcca
gataagccaaaaggcacagccagaagaaaacctgccaagaagaataaaagccaaaagaag
aatgccacaactcccttgaaacagtggaaagttggtgacaagtgttctgctgtttggtca
gaagacggctgcatttacccagctactattacgtccattgactttaagagagaaacctgt
gtcgtggtttatactggatatggaaacagagaggagcaaaacttatctgacctactttcc
ccgacctgtgaagtagctaatagtacagaacagaacactcaggagaatgaaagtcaagtt
tccacagacgacagtgaacactcctccagatcgctcagaagtaaagcacacagcaagtcc
aaagctgctccgtggacctcatttcttcctccaccacccccaatgccagggtcaggatta
ggaccaggaaagccaggtctaaaattcaacggcccgccgccgccgcctccactaccccct
ccccccttcctgccgtgctggatgcccccgttcccttcaggaccaccaataatcccgcca
ccccctcccatctctcccgactgtctggatgacactgatgccctgggcagtatgctaatc
tcttggtacatgagtggctaccacactggctactatatgggtttcagacaaaataaaaaa
gaaggaaagtgctcacatacaaattaa

DBGET integrated database retrieval system