KEGG   Mus musculus (mouse): 20656Help
Entry
20656             CDS       T01002                                 

Gene name
Sod2, MnSOD, Sod-2
Definition
(RefSeq) superoxide dismutase 2, mitochondrial (EC:1.15.1.1)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Peroxisome
Longevity regulating pathway
Longevity regulating pathway - multiple species
Huntington's disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    20656 (Sod2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    20656 (Sod2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    20656 (Sod2)
   04213 Longevity regulating pathway - multiple species
    20656 (Sod2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    20656 (Sod2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     20656 (Sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 A1; 17 8.75 cM
AA seq 222 aa AA seqDB search
MLCRAACSTGRRLGPVAGAAGSRHKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNATEEKYHEALAKGDVTTQVALQPALKFNGGGHINHTIFWTNLSPKGGGEPKGELLEA
IKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYTACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtcgggcggcgtgcagcacgggcaggaggctgggccctgtggccggtgccgcg
ggctcccggcacaagcacagcctcccagacctgccttacgactatggcgcgctggagcca
cacattaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aatctcaacgccaccgaggagaagtaccacgaggctctggccaagggagatgttacaact
caggtcgctcttcagcctgcactgaagttcaatggtgggggacatattaatcacaccatt
ttctggacaaacctgagccctaagggtggtggagaacccaaaggagagttgctggaggct
atcaagcgtgactttgggtcttttgagaagtttaaggagaagctgacagccgtgtctgtg
ggagtccaaggttcaggctggggctggcttggcttcaataaggagcaaggtcgcttacag
attgctgcctgctctaatcaggacccattgcaaggaacaacaggccttattccgctgctg
gggattgacgtgtgggagcacgcttactaccttcagtataaaaacgtcagacctgactat
ctgaaagctatttggaatgtaatcaactgggagaatgttactgaaagatacacagcttgc
aagaagtga

DBGET integrated database retrieval system