KEGG   Mus musculus (mouse): 20868Help
Entry
20868             CDS       T01002                                 

Gene name
Stk10, Gek1, Lok, mKIAA4026
Definition
(RefSeq) serine/threonine kinase 10 (EC:2.7.11.1)
  KO
K08837  
serine/threonine kinase 10 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20868 (Stk10)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   20868 (Stk10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 18.97 cM; 11 A4
AA seq 966 aa AA seqDB search
MAFANFRRILRLSTFEKRKSREYEHVRRDLDPNDVWEIVGELGDGAFGKVYKAKNKETGA
LAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYYDGKLWIMIEFCPGGAVDA
IMLELDRGLTEPQIQVVCRQMLEALNFLHGKRIIHRDLKAGNVLMTLEGDIRLADFGVSA
KNLKTLQKRDSFIGTPYWMAPEVVLCETMKDAPYDYKADIWSLGITLIEMAQIEPPHHEL
NPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLQHPFVSRVTSN
KALRELVAEAKAEVMEEIEDGREDGEEEDAVDAVPPLVNHTQDSANVTQPSLDSNKLLQD
SSTPLPPSQPQEPVSGSCSQPSGDGPLQTTSPADGLSKNDNDLKVPVPLRKSRPLSMDAR
IQMDEEKQIPDQDENPSPAASKSQKANQSRPNSSALETLGGEALTNGGLELPSSVTPSHS
KRASDCSNLSTSESMDYGTSLSADLSLNKETGSLSLKGSKLHNKTLKRTRRFVVDGVEVS
ITTSKIISEDEKKDEEMRFLRRQELRELRLLQKEEHRNQTQLSSKHELQLEQMHKRFEQE
INAKKKFYDVELENLERQQKQQVEKMEQDHSVRRKEEAKRIRLEQDRDYAKFQEQLKQMK
KEVKSEVEKLPRQQRKESMKQKMEEHSQKKQRLDRDFVAKQKEDLELAMRKLTTENRREI
CDKERDCLSKKQELLRDREAALWEMEEHQLQERHQLVKQQLKDQYFLQRHDLLRKHEKER
EQMQRYNQRMMEQLKVRQQQEKARLPKIQRSDGKTRMAMYKKSLHINGAGSASEQREKIK
QFSQQEEKRQKAERLQQQQKHENQMRDMVAQCESNMSELQQLQNEKCHLLVEHETQKLKA
LDESHNQSLKEWRDKLRPRKKALEEDLNQKKREQEMFFKLSEEAEPRPTTPSKASNFFPY
SSGDAS
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgccaatttccgccgcatcttgcggttatccaccttcgagaagagaaagtcc
cgtgaatatgagcacgtccgccgggacctggaccccaacgatgtatgggagatcgtgggc
gagctgggagacggcgccttcggcaaagtctacaaggccaaaaacaaggagaccggtgcc
ctggcagcagccaaagtcatagagaccaagagcgaggaggagctggaggactacatcgtg
gagatagagatcctggccacctgtgaccacccgtatatcgtgaagctcctgggggcctat
tactatgatgggaagctctggatcatgattgagttctgccctgggggagctgtggatgcc
atcatgctggagctggatcgaggcctcactgagccccagattcaggtcgtatgccgccag
atgttggaggctctcaacttcctgcacggcaagaggatcatccaccgagacctgaaagct
ggcaacgtgcttatgacccttgagggggacatcaggctggctgattttggtgtgtctgcc
aagaatctgaaaactctgcaaaagcgagactccttcatagggacaccttactggatggcc
cctgaggtggtgctgtgtgaaaccatgaaggacgccccctatgactacaaggctgacatc
tggtccttgggcatcacgctgatcgagatggcgcagatcgagcccccacaccacgagctc
aaccccatgcgggtcctgctcaagattgccaagtcggaccctcctaccctgcttacaccc
tccaagtggtctgtggagttccgagactttctgaagatagccttggataagaacccagaa
acccggcccagtgctgcacagctgctgcagcatcccttcgtcagcagagtcaccagcaat
aaggctcttcgggagctggtggccgaggcaaaggcggaggtaatggaggagattgaggat
ggcagggaggacggagaagaggaggatgctgtggatgctgttccgcccctggtcaaccac
actcaggactctgccaatgtaactcagccaagcctcgactccaacaagcttctccaggat
tcttccacccccctgcctcccagccagcctcaggagcctgtgagcgggtcctgtagccaa
ccctctggggatggacccctccaaaccaccagccctgcagatgggctctccaagaatgac
aatgacttaaaggtgcctgttcccctccggaagtcccggccactgtccatggatgccaga
attcagatggatgaagagaaacaaatccctgaccaggatgagaacccgagtcctgcagcc
agcaagtcccaaaaggccaaccagagccgacctaacagcagtgccctggagaccttgggt
ggcgaggctctgaccaacggtggcctggaactccccagctctgtcactccaagccattct
aagagggcctcggactgtagcaacctgtctacctcagagagcatggactatggcacctcc
ctgtctgctgacctgtcactgaacaaagaaacgggctcattgtctctcaagggctcaaaa
ctgcacaataagaccctgaaacggacccgccggtttgtggtggatggtgtggaggtgagc
atcaccacctccaagatcatcagcgaggatgagaagaaagacgaggagatgagatttctc
aggcgccaggagctccgagagcttcggcttctgcagaaagaagaacatcggaaccagacg
cagctgagcagcaagcacgagctgcagctggagcagatgcacaaacgttttgaacaagaa
atcaacgccaagaagaaattctatgacgtggagctagaaaacctggagcggcagcagaag
cagcaggtagagaagatggagcaggaccacagcgtgcgccgcaaagaggaggccaagcgg
atccgcctggagcaggatcgagactacgccaagttccaagagcaactcaagcaaatgaag
aaggaggtgaagagtgaggttgagaaactgccccggcagcagcggaaggagagcatgaag
cagaagatggaggaacactctcagaagaaacagcggctggaccgggactttgtagccaag
cagaaggaggacctggagctggccatgaggaagctcaccacggaaaacaggcgtgagatc
tgcgacaaggaacgagattgccttagcaagaagcaggagctcctccgagaccgtgaggcg
gccctgtgggagatggaggagcaccagttgcaggagcgacatcagctggtgaagcagcaa
ctgaaggaccagtacttcctgcagcggcatgacctgctgcgtaagcatgagaaggagcgg
gaacagatgcagcgctacaaccagcgcatgatggagcagctgaaggtcagacagcaacag
gagaaggcgcggctacccaagatccagaggagcgacggcaagacgcgcatggccatgtac
aagaagagcctgcacatcaacggtgcgggcagtgcctctgagcagcgcgagaagatcaag
cagttctcccagcaggaggagaagaggcagaaggcggagaggctgcagcagcagcagaaa
cacgagaaccagatgcgagacatggtggcgcagtgtgaaagcaacatgagcgagctacag
cagctgcagaatgaaaagtgtcatctgttggtagagcatgaaacccagaagctgaaggcc
ctggatgagagccacaaccagagcctgaaggaatggcgagacaagcttcggccacgcaaa
aaggccctggaagaggatttgaaccagaagaagcgggaacaggaaatgttcttcaaatta
agcgaggaggcagagcccagacccaccacacccagcaaagccagcaacttcttcccctac
agctctggggatgcttcctaa

DBGET integrated database retrieval system