KEGG   Mus musculus (mouse): 20907Help
Entry
20907             CDS       T01002                                 

Gene name
Stx1a, HPC-1
Definition
(RefSeq) syntaxin 1A (brain)
  KO
K04560  
syntaxin 1A
Organism
mmu  Mus musculus (mouse)
Pathway
SNARE interactions in vesicular transport
Synaptic vesicle cycle
Insulin secretion
Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    20907 (Stx1a)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    20907 (Stx1a)
  Nervous system
   04721 Synaptic vesicle cycle
    20907 (Stx1a)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    20907 (Stx1a)
SNAREs [BR:mmu04131]
 Syntaxin (Qa)
  Stx-PM
   20907 (Stx1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 G2
AA seq 288 aa AA seqDB search
MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH
STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASG
IIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccgaacccaggagctccgcacggccaaggacagcgatgacgacgacgatgtc
actgtcactgtggaccgagaccgcttcatggatgaattctttgaacaggtggaagagatc
cggggctttattgacaagattgccgaaaacgtggaggaggtgaagcggaaacacagcgcc
atcctggcctccccgaaccccgatgagaagacaaaggaggaactggaggagctcatgtcg
gacattaagaagacagcgaacaaagttcgctccaagctaaagagcattgagcagagcatc
gagcaggaggaaggtctgaaccgctcatcagccgacctgaggatccggaagacgcagcac
tccacgctgtcccgaaagtttgtggaggtcatgtccgagtacaacgccactcagtcagac
taccgagaacgctgcaaagggcgcatccagaggcagctggagatcaccggccggaccacg
accagtgaggaattggaagacatgctggagagtgggaaccctgccatctttgcctctggg
atcatcatggactccagcatctcgaagcaggccctcagtgagatcgagaccagacacagt
gagatcatcaagctggagaccagcatccgggagctgcacgacatgttcatggacatggcc
atgctggtggagagccagggggagatgattgacaggatcgagtacaatgtggagcacgcc
gtggactacgtggagagggccgtgtcagacaccaagaaggccgtcaagtaccagagcaag
gcgcgcaggaagaagatcatgatcatcatttgctgtgtgattctgggcatcatcatcgcc
tccaccatcgggggcatctttggatag

DBGET integrated database retrieval system