KEGG   Mus musculus (mouse): 214663Help
Entry
214663            CDS       T01002                                 

Gene name
Slc25a29, C030003J19Rik, CACL, mCACL
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier, palmitoylcarnitine transporter), member 29
  KO
K15109  
solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29
Organism
mmu  Mus musculus (mouse)
Brite
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   214663 (Slc25a29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
12; 12 F1
AA seq 306 aa AA seqDB search
MALDFLAGCAGGVAGVIVGHPFDIVKVRLQVQSTEKPQYRGTLHCFQSIIKQESVLGLYK
GLGSPLMGLTFINALVFGVQGNTLRALGQDSPLNQFLAGAAAGAIQCVICCPMELAKTRL
QLQAVGPARTYKGSLDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVMTRAMG
CEPGDRLLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSYQ
AEGWQVFTRGLASTLLRAFPVNAATFATVTVVLTYTRGEEAQVDSEAALGTSPTPAGSAL
AQPSSL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgacttcctggctggatgcgccggaggtgtggcaggtgtgatcgtgggacac
ccttttgacatagtcaaggtgcggctgcaagttcagagcacagagaagcctcagtacaga
gggacgctgcactgcttccagtccatcatcaagcaggagagtgtgctgggcctgtataaa
ggcctgggctcgccactaatgggactcaccttcatcaatgcactggtgtttggggtgcaa
ggtaacaccctccgggccctgggccaagactcaccactcaatcagttcctggccggtgca
gcagcaggcgccattcagtgtgtcatctgctgccccatggaactggccaagacgaggctg
cagctccaggccgtgggtcctgcccgtacctacaagggctccctggactgcctggtgcag
atttaccggcatgagggcctgcgcggcatcaatcgaggcatggtgtccacacttctgcgg
gagacgccaagctttggcgtctacttcctcacctatgatgtaatgacccgcgccatgggc
tgcgagccaggtgaccgcctgctggtgcctaagctgctgctggcgggtggcacgtcgggg
atcacatcctggctctccacttatcccatggacgtggttaagtcacgactgcaagccgac
gggctacaaggaacccctcgctaccgcggcatcgtcgactgcatgcggcagagctaccag
gccgagggctggcaagtcttcacgcgagggctggcctccacgctgctccgtgccttcccg
gtcaatgctgccacctttgccacagtcactgtggtgcttacatatacccggggcgaggag
gctcaggtagacagtgaggcagctctgggcacctctcccactcctgctgggtctgccctg
gcccagccttccagtctgtga

DBGET integrated database retrieval system