KEGG   Mus musculus (mouse): 216188Help
Entry
216188            CDS       T01002                                 

Gene name
Aldh1l2, D330038I09Rik, mtFDH
Definition
aldehyde dehydrogenase 1 family, member L2 (EC:1.5.1.6)
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mmu00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 C1; 10
AA seq 923 aa AA seqDB search
MLWRGSQALRHFSTSRVYFKNKLKLALIGQSLFGQEVYSQLLKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKFPRWRLKGKTIKEVAEAYQSVGAELNVLPFCTQFIPMDVIDSP
KHGSIIYHPSLLPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVKPND
TVDSLYNRFLFPEGIKAMVEAVQLIADGKAPRTPQPEEGATYEGIQKKENAEVSWDQPAE
GLHNWIRGHDKVPGAWAEINGQMVTFYGSSLLTSSVPSGEPLDIRGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGKMIPASQYFSAGETSVVELTAEELKVAETIKVIWARILSNTP
VIEDSTDFFKSGASSMDVVRLVEEIRQSCGGLQLQNEDVYMATKFGDFIQKVVRRLRGED
EEAEMVVDYVSKEVNGMTVKIPYQCFINGQFVDAEDGETYATVNPTDGTTICRVSYASLA
DVDRAVAAAKDAFENGEWGRMNARDRGRLMYRLADLMEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNYNLTFTKKEPLGACAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELTVKAGFPKGVINIIPGSGGVAGQRLSQ
HPDIRKLGFTGSTSVGKQIMKSCAVSNLKKVSLELGGKSPLIIFSDCDLEKAVRMGMGAV
FFNKGENCIAAGRLFVEEAIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHRAHLEKLL
QYCETGVQEGATLVYGGRQVQRPGFFMEPTVFTGVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDINKAMYVSDKLEAGTVFINTYNKTDVAAPFGGMKQSG
FGKDLGEEALNEYLKIKTVTLEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggcggggtagccaggcgctacggcacttctccaccagccgggtttatttcaaa
aacaagctgaagttggcacttattggccagagcctgttcggacaggaagtctatagccag
ctcctgaaagagggccaccgagtagtgggagtgttcacagtgccagacaaggatggaaag
gccgatccactggctttggctgcagagaaagatgggactcccgtgttcaagttccctcga
tggagactcaagggtaaaaccatcaaggaggtagcagaagcttaccagtcggtgggagcc
gagctcaacgtgctccccttctgcacacagttcatccccatggatgtcattgacagccca
aagcatggctccatcatctaccacccctcactcctacccaggcacagaggagcttctgcc
atcaactggacactaatcatgggagataagaaagctgggttttctgttttctgggcagat
gatggtttggatacaggacccatccttcttcagagatcgtgtgacgtcaagcccaatgac
acagtggactcgctttataaccggttcctttttcctgaggggatcaaggccatggtagaa
gccgtccaactcatagctgatggaaaagcgcctcgcactccccagccagaagagggggca
acatatgaaggcatccagaagaaggagaacgctgaggtttcttgggaccagcctgctgaa
ggtttgcataactggattcgaggtcatgacaaggtccctggagcctgggcagagatcaat
ggacagatggtgactttctacggctcatcactgttgactagttctgtgccttctggagaa
ccactggacattagaggtgccaagaagcccggtcttgtcaccaaaaatggccttgtcctt
tttgggaatgatggaaaagcactgatggtgagaaacctgcagtttgaggacggaaagatg
attccagcctcccagtacttttctgcgggtgagacatcagtggtagaacttacggccgag
gagctgaaggtggcagagaccattaaggtcatctgggctcgaattttaagcaacacccct
gtgattgaggactccacggacttctttaaatctggagcgagctcaatggatgttgtgagg
ctggtggaagagatcagacagagttgcggagggcttcagctgcagaatgaagacgtctac
atggccaccaagtttggagatttcatccaaaaggttgtgcggagactgagaggagaggac
gaagaggcagagatggtggtggattacgtttccaaggaggtgaacgggatgacagtgaaa
atcccctaccagtgtttcataaatggacagtttgtggatgccgaggatggagagacttac
gccactgtcaaccccacagatggaactacaatatgcagagtgtcctacgcttctttagcg
gatgttgacagagcagtagccgcagccaaggacgcctttgagaacggcgaatgggggagg
atgaacgccagagacagaggaagactcatgtacagactcgctgacctaatggaagaaaac
caagaagagctggccaccatagaagcgctggattccggggctgtctacaccctggctctg
aagactcacattggaatgtctgtgcagacgttcagatacttcgcaggctggtgtgacaaa
attcagggttctacaattccaatcaaccaggcccggccgaattacaacctgaccttcacc
aagaaggagccacttggtgcctgtgccattatcattccttggaactacccactgatgatg
ctggcctggaagagcgcagcgtgcctggcggcaggcaacaccctggtgctcaagcctgca
caggtcacacccttgacggctctgaagtttgcagagctgaccgtgaaagctggctttccc
aagggggtgattaacatcattccaggctcagggggtgtcgcaggacagaggctctctcag
caccctgacatccgcaagcttggcttcactggatccacctcagtgggcaaacagatcatg
aaaagctgtgctgtgagcaacctgaagaaagtttcccttgagcttggtggcaaatcccca
ctgataatattcagtgattgtgaccttgaaaaggctgtacggatgggcatgggcgcagtg
tttttcaataaaggagagaactgcattgcagctgggcggctgtttgtggaagaggccatc
cacgacgaattcgtaaccagagtggtggaagagattaaaaagatgaaaattggagatccc
ctggacagatctacggaccatgggccccagaaccacagagcgcacttggaaaagctgctg
cagtactgtgagactggggtgcaggagggggccacactggtgtatggaggaagacaggtg
cagaggccaggcttcttcatggaacccactgtgttcacaggcgtggaagatcacatgtac
cttgccaaggaggaatcctttgggcctatcatggtcatttctaaattccaaaatggggac
atcgatggggtgttgcagagagcaaataacactgaatatggcttggcctcaggggtcttc
acaagagacatcaacaaagccatgtatgtgagtgacaagctagaggcgggaacggttttc
attaacacctacaacaagacagacgtggcagccccatttggtggaatgaagcaatctggc
tttggaaaagacttaggtgaggaggccctgaatgaatacctgaaaatcaaaacagtgaca
ctcgagtattag

DBGET integrated database retrieval system