KEGG   Mus musculus (mouse): 21991Help
Entry
21991             CDS       T01002                                 

Gene name
Tpi1, AI255506, Tpi, Tpi-1
Definition
(RefSeq) triosephosphate isomerase 1
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00051  Fructose and mannose metabolism
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmu_M00002  Glycolysis, core module involving three-carbon compounds
mmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    21991 (Tpi1)
   00051 Fructose and mannose metabolism
    21991 (Tpi1)
   00562 Inositol phosphate metabolism
    21991 (Tpi1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     21991 (Tpi1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   21991 (Tpi1)
  Exosomal proteins of bladder cancer cells
   21991 (Tpi1)
  Exosomal proteins of melanoma cells
   21991 (Tpi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM GCM
Motif
Other DBs
NCBI-GeneID: 21991
NCBI-ProteinID: NP_033441
MGI: 98797
Ensembl: ENSMUSG00000023456
Vega: OTTMUSG00000017534
UniProt: P17751
Position
6 F2; 6 59.17 cM
AA seq 299 aa AA seqDB search
MEGKAEQQGAGLTMAEGGEKEEFCFTAIYISGQWREPCVCTDLQRLEPGTMAPTRKFFVG
GNWKMNGRKKCLGELICTLNAANVPAGTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKV
TNGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDELIGQKVSHALAEGLGVIACIGE
KLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR
GWLKSNVNDGVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaggggaaggcggagcagcaaggggccgggctaaccatggcggagggcggggagaag
gaggagttctgcttcacagccatctatataagtggccagtggagagagccgtgcgtttgt
actgaccttcagagacttgagcctggtacaatggcgcctaccaggaagttcttcgttggg
ggcaactggaagatgaacgggaggaagaagtgcctgggagaactcatctgcaccctgaac
gcagccaacgtgccggcaggcaccgaggtggtttgtgcaccgcccaccgcttacatcgac
tttgccagacagaagctggatcccaaaattgctgtggccgcacagaactgctacaaagtg
accaatggggccttcactggggaaatcagccctggcatgatcaaagacttaggagccacc
tgggtcgtgctggggcactcagaaagaagacatgtctttggagaatcagatgagctgatt
ggccagaaagtgagccacgccctagcagagggactcggggtgatcgcctgcatcggggag
aagctagacgaaagggaagccggcatcaccgagaaggtcgtgttcgagcaaaccaaggtc
atcgcagataatgtgaaagactggagcaaggtggtcctggcctatgaacctgtgtgggcc
attgggactggcaagacggcaacccctcagcaggcacaggaagtacacgagaagctccgg
ggatggctgaaatccaatgtcaatgatggggtggctcagagcacccggatcatttatgga
ggttctgtgactggagcaacctgcaaagagctggcaagccagcctgacgtggacggcttc
cttgtgggtggcgcatctctcaagcctgaatttgtggacatcatcaatgccaaacaatga

DBGET integrated database retrieval system