KEGG   Mus musculus (mouse): 21991Help
Entry
21991             CDS       T01002                                 

Gene name
Tpi1, AI255506, Tpi, Tpi-1
Definition
triosephosphate isomerase 1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    21991 (Tpi1)
   01230 Biosynthesis of amino acids
    21991 (Tpi1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    21991 (Tpi1)
   00051 Fructose and mannose metabolism
    21991 (Tpi1)
   00562 Inositol phosphate metabolism
    21991 (Tpi1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     21991 (Tpi1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   21991 (Tpi1)
  Exosomal proteins of bladder cancer cells
   21991 (Tpi1)
  Exosomal proteins of melanoma cells
   21991 (Tpi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 F2; 6 59.17 cM
AA seq 299 aa AA seqDB search
MEGKAEQQGAGLTMAEGGEKEEFCFTAIYISGQWREPCVCTDLQRLEPGTMAPTRKFFVG
GNWKMNGRKKCLGELICTLNAANVPAGTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKV
TNGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDELIGQKVSHALAEGLGVIACIGE
KLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLR
GWLKSNVNDGVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaggggaaggcggagcagcaaggggccgggctaaccatggcggagggcggggagaag
gaggagttctgcttcacagccatctatataagtggccagtggagagagccgtgcgtttgt
actgaccttcagagacttgagcctggtacaatggcgcctaccaggaagttcttcgttggg
ggcaactggaagatgaacgggaggaagaagtgcctgggagaactcatctgcaccctgaac
gcagccaacgtgccggcaggcaccgaggtggtttgtgcaccgcccaccgcttacatcgac
tttgccagacagaagctggatcccaaaattgctgtggccgcacagaactgctacaaagtg
accaatggggccttcactggggaaatcagccctggcatgatcaaagacttaggagccacc
tgggtcgtgctggggcactcagaaagaagacatgtctttggagaatcagatgagctgatt
ggccagaaagtgagccacgccctagcagagggactcggggtgatcgcctgcatcggggag
aagctagacgaaagggaagccggcatcaccgagaaggtcgtgttcgagcaaaccaaggtc
atcgcagataatgtgaaagactggagcaaggtggtcctggcctatgaacctgtgtgggcc
attgggactggcaagacggcaacccctcagcaggcacaggaagtacacgagaagctccgg
ggatggctgaaatccaatgtcaatgatggggtggctcagagcacccggatcatttatgga
ggttctgtgactggagcaacctgcaaagagctggcaagccagcctgacgtggacggcttc
cttgtgggtggcgcatctctcaagcctgaatttgtggacatcatcaatgccaaacaatga

DBGET integrated database retrieval system