KEGG   Mus musculus (mouse): 22003Help
Entry
22003             CDS       T01002                                 

Gene name
Tpm1, AA986836, AI854628, TM2, Tm3, Tmpa, Tpm-1, alpha-TM
Definition
tropomyosin 1, alpha
Orthology
K10373  
tropomyosin 1
Organism
mmu  Mus musculus (mouse)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Class
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:mmu04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:mmu04261]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mmu05206]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:mmu05410]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:mmu05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
9 C; 9 36.27 cM
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaagagaacgccttggat
cgagctgagcaagcggaggctgataagaaggcggcggaagaccggagcaagcagctggaa
gatgagctggtgtcactgcaaaagaaactcaagggcactgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaaactggagctggcggagaaaaaggccacagat
gctgaagctgacgtagcttctctgaacagacgcatccagctggttgaggaggagttggat
cgtgctcaggagcgtctggccacagctctgcagaagctggaggaggccgagaaggctgca
gatgagagtgagagaggcatgaaagtcattgaaagccgagcccaaaaagatgaagaaaag
atggagattcaggagatccagctgaaagaggccaagcacattgctgaagatgctgaccgg
aagtatgaagaggtggcccgtaagctggtcatcatcgagagcgacctggaacgtgcagag
gagcgggctgagctctcagaaggcaaatgtgccgagcttgaagaagaattgaaaacggtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactctcagaaggaagacaaa
tatgaagaggagatcaaggttctctctgacaagctgaaggaggctgaaactcgggctgag
tttgcagagagatcagtaaccaaattggagaaaagcattgatgacttagaagacgagctg
tatgctcagaaactgaagtacaaggccatcagcgaggagctggaccacgctctcaacgat
atgacttccatataa

DBGET integrated database retrieval system