KEGG   Mus musculus (mouse): 22003Help
Entry
22003             CDS       T01002                                 

Gene name
Tpm1, AA986836, AI854628, TM2, Tm3, Tmpa, Tpm-1, alpha-TM
Definition
tropomyosin 1, alpha
Orthology
K10373  
tropomyosin 1
Organism
mmu  Mus musculus (mouse)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    22003 (Tpm1)
   04261 Adrenergic signaling in cardiomyocytes
    22003 (Tpm1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    22003 (Tpm1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    22003 (Tpm1)
   05414 Dilated cardiomyopathy (DCM)
    22003 (Tpm1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   22003 (Tpm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
9 C; 9 36.27 cM
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaagagaacgccttggat
cgagctgagcaagcggaggctgataagaaggcggcggaagaccggagcaagcagctggaa
gatgagctggtgtcactgcaaaagaaactcaagggcactgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaaactggagctggcggagaaaaaggccacagat
gctgaagctgacgtagcttctctgaacagacgcatccagctggttgaggaggagttggat
cgtgctcaggagcgtctggccacagctctgcagaagctggaggaggccgagaaggctgca
gatgagagtgagagaggcatgaaagtcattgaaagccgagcccaaaaagatgaagaaaag
atggagattcaggagatccagctgaaagaggccaagcacattgctgaagatgctgaccgg
aagtatgaagaggtggcccgtaagctggtcatcatcgagagcgacctggaacgtgcagag
gagcgggctgagctctcagaaggcaaatgtgccgagcttgaagaagaattgaaaacggtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactctcagaaggaagacaaa
tatgaagaggagatcaaggttctctctgacaagctgaaggaggctgaaactcgggctgag
tttgcagagagatcagtaaccaaattggagaaaagcattgatgacttagaagacgagctg
tatgctcagaaactgaagtacaaggccatcagcgaggagctggaccacgctctcaacgat
atgacttccatataa

DBGET integrated database retrieval system