KEGG   Mus musculus (mouse): 22139Help
Entry
22139             CDS       T01002                                 

Gene name
Ttr, AA408768, AI787086, D17860, prealbumin
Definition
(RefSeq) transthyretin
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
18 A2; 18 11.47 cM
AA seq 147 aa AA seqDB search
MASLRLFLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGS
WEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDS
GHRHYTIAALLSPYSYSTTAVVSNPQN
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccttcgactcttcctcctttgcctcgctggactggtatttgtgtctgaagct
ggccccgcgggtgctggagaatccaaatgtcctctgatggtcaaagtcctggatgctgtc
cgaggcagccctgctgtagacgtggctgtaaaagtgttcaaaaagacctctgagggatcc
tgggagccctttgcctctgggaagaccgcggagtctggagagctgcacgggctcaccaca
gatgagaagtttgtagaaggagtgtacagagtagaactggacaccaaatcgtactggaag
acacttggcatttccccgttccatgaattcgcggatgtggttttcacagccaacgactct
ggccatcgccactacaccatcgcagccctgctcagcccatactcctacagcaccacggct
gtcgtcagcaacccccagaattga

DBGET integrated database retrieval system