KEGG   Mus musculus (mouse): 22139Help
Entry
22139             CDS       T01002                                 

Gene name
Ttr, AA408768, AI787086, D17860, prealbumin
Definition
(RefSeq) transthyretin
  KO
K20731  
transthyretin
Organism
mmu  Mus musculus (mouse)
Pathway
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    22139 (Ttr)
Transporters [BR:mmu02000]
 Other Transporters
  Others
   22139 (Ttr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
18 A2; 18 11.47 cM
AA seq 147 aa AA seqDB search
MASLRLFLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGS
WEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDS
GHRHYTIAALLSPYSYSTTAVVSNPQN
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccttcgactcttcctcctttgcctcgctggactggtatttgtgtctgaagct
ggccccgcgggtgctggagaatccaaatgtcctctgatggtcaaagtcctggatgctgtc
cgaggcagccctgctgtagacgtggctgtaaaagtgttcaaaaagacctctgagggatcc
tgggagccctttgcctctgggaagaccgcggagtctggagagctgcacgggctcaccaca
gatgagaagtttgtagaaggagtgtacagagtagaactggacaccaaatcgtactggaag
acacttggcatttccccgttccatgaattcgcggatgtggttttcacagccaacgactct
ggccatcgccactacaccatcgcagccctgctcagcccatactcctacagcaccacggct
gtcgtcagcaacccccagaattga

DBGET integrated database retrieval system