KEGG   Mus musculus (mouse): 22223Help
Entry
22223             CDS       T01002                                 

Gene name
Uchl1, AW822034, C88048, PGP_9.5, PGP9.5, R75593, UCH-L1, UCHL-1, gad
Definition
ubiquitin carboxy-terminal hydrolase L1 (EC:3.4.19.12)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Pathway
Parkinson's disease
Class
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:mmu05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 C3.1; 5 35.95 cM
AA seq 223 aa AA seqDB search
MQLKPMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSE
TEKLSPEDRAKCFEKNEAIQAAHDSVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaagccgatggagattaaccccgagatgctgaacaaagtgttggccaagctg
ggggtcgccggccagtggcgcttcgccgacgtgctagggctggaggaggagactctgggc
tcagtgccatcccctgcctgcgccctgctgctcctgtttcccctcacggcccagcatgaa
aacttcaggaaaaagcaaattgaggaactgaagggacaggaagttagccctaaagtttac
ttcatgaagcagaccatcggaaactcctgtggtaccatcgggttgatccacgcagtggcc
aacaaccaagacaagctggaatttgaggatggatccgtcctgaaacagtttctgtctgaa
acggagaagctgtcccccgaagatagagccaagtgtttcgagaagaacgaggccatccag
gcggcccatgactccgtggcccaggagggccagtgtcgggtagatgacaaagtgaatttc
cattttattctgttcaacaacgtggacggccatctgtacgagctcgatgggcgaatgccc
tttccagtgaaccatggcgccagctcagaggactctctgctgcaggatgctgccaaggtc
tgcagagaattcactgagcgcgagcagggggaggtccgcttctctgccgtggctctctgc
aaagcagcttaa

DBGET integrated database retrieval system