KEGG   Mus musculus (mouse): 22249Help
Entry
22249             CDS       T01002                                 

Gene name
Unc13b, Munc13-1, Munc13-2, Unc13a, Unc13h1, Unc13h2
Definition
unc-13 homolog B (C. elegans)
Orthology
K15293  
protein unc-13
Organism
mmu  Mus musculus (mouse)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    22249 (Unc13b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 B1; 4
AA seq 1602 aa AA seqDB search
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTKNPTPHK
ILLDTRFELPFDIPEEEARYWTYKLEQINALADDNEYSSQEESQRKPLPTAAAQCCHWTY
LGWGEHQTFEDPDSAVDDRDSDYRSETSNSAPPPYHTTTQPNASVHQFPVPVRLPQQLFL
QGSSHDSCNDSMQSYDLDYPERRALSPTSSSRYGSSCNVSQGSSLLSELDQYHEQDDDGR
ERDSIHSSHSYGSLSKDGQAGLGEQEKALEVTCESEKEKTGESKEMRDDATIHPPSDLVL
HKDHVLGPQESLPEETASSPFTQARAHWFRAVTKVRLQLQEISDDGDPSLPQWLPEGPAG
GLYGIDSMPDLRRKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQAL
IYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCL
QRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVK
QSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWE
EKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYN
LEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVWIPEA
RGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANI
NAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQ
DLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQ
LQEQPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLSQFPQELNVGKVSAEVMWH
LFAQDMKYALEEHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPAWFEQFV
LQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECP
DPNILAHYMRRFAKTIGKVLMQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFE
AMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGN
ASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIV
LPPLTDQTGTQLILTAAKELSQLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAG
GNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQGAGVDDPVGEVSIQVDL
FTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWTP
KYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSCACWCPLG
RKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRSTEEGS
NT seq 4809 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgctctgtgtgcgtgttaaaagagccaaattccagggttcaccagataaattt
aacacatatgtgaccctgaaagtccagaacgtgaagagcacaactgtagcagttcgtggt
gatcagccttcctgggagcaggatttcatgtttgagatcagtcgtctggacctgggccta
agtgtggaggtgtggaacaagggactgatatgggacacaatggtgggcaccgtgtggatt
gcactgaagacaatccgtcagtcggatgaggaagggcccggggagtggtctacactggag
gcagagacgttaatgaaagatgatgagatctgtggaactaaaaatccaactcctcataaa
atcttgcttgatacaagatttgagctgccttttgacatcccagaggaggaagccagatat
tggacctacaaattggagcaaatcaatgccttggcagatgataatgagtattctagtcaa
gaagaaagccagaggaagccattacccactgctgccgcccagtgttgtcactggacctat
ttgggctggggagagcatcagacctttgaagaccctgatagtgccgttgatgaccgagac
agtgactaccgcagtgagaccagcaatagcgccccacctccttaccacacgactacccag
cccaacgcttctgtacaccagttccctgttcctgtgcggctgccacagcagctctttctt
caaggcagttcccatgactcttgcaatgactctatgcagagttacgaccttgattatcca
gagcgtcgggccctcagccctaccagcagtagtaggtatggctcctcctgtaatgtgagt
caaggaagctctctgctgagtgagctggaccagtatcatgagcaagatgatgatggtcgg
gagagggactccattcattctagtcatagctatggcagcctctccaaagatggccaggct
ggtttgggagaacaagagaaagccttggaagtgacatgtgaatcagaaaaagagaaaaca
ggtgaatccaaggagatgagagatgatgctacaatccaccctccttcagatctggtgctg
cataaggaccatgtcctaggaccccaggagagtcttcctgaggagaccgcatcatcgcca
tttacccaggccagagcacactggttccgagcggttaccaaggtccgactccaactgcag
gagatttcagatgatggtgacccctccttgcctcagtggctcccagaagggccagctgga
gggctctatggcattgacagcatgccagatctacgaaggaagaagccactgccacttgtc
agtgatctgtcactggtccagtcacggaaagctgggattacatctgctatggctacacgt
acctctctcaaggatgaagaactgaaatctcatgtgtataagaaaactctgcaggcctta
atctaccccatctcgtgtaccacgccccacaactttgaggtctggtctgccactacacct
acctattgctatgagtgtgaaggcttgctctggggccttgcccggcaaggcatgcgctgc
agcgagtgtggagtcaagtgccatgagaagtgccaggacctgctcaatgctgactgccta
cagcgggctgctgaaaagagctctaagcatggagctgaggaccgaactcagaacattatc
atggccatgaaggaccgtatgaagatccgagaacggaataaaccagagatctttgaggtt
atccgggatgtgttcacagtgagcaaagttgcgcatgtgcagcagatgaaaacagtaaag
cagagtgtcctggatggcacctccaagtggtcagccaaaattaccatcacggtggtttgt
gcccagggcctacaagccaaagacaagacaggatccagtgacccttatgtgactgtgcaa
gttgggaaaaccaagaagcgcaccaagaccatttttggaaatttgaatcctgtttgggaa
gagaagttccattttgagtgccacaactcttctgatcgaattaaggtacgcgtgtgggat
gaggatgatgacatcaagtccagagtaaagcagcggctaaagcgagagtcagatgatttc
cttggccaaactatcattgaagttcgaacgctgagtggagagatggatgtctggtacaat
ctggagaagagaacagacaagtcagctgtctcaggggctatccgacttcaaatcagtgtg
gagatcaagggggaggagaaggtagccccataccatgtacaatatacatgtctccatgag
aaccttttccattacctcacagacattcagggcagtggaggagtctggatcccagaggct
cggggggacgatgcatggaaggtgtactttgatgagacagcccaagaaattgtggatgaa
ttcgctatgcgctatggcatcgagtccatttatcaggccatgacgcactttgcatgtttg
tcatccaagtacatgtgtcctggtgtaccagccgtgatgagcaccttactggccaacatc
aatgcctattatgctcacacaactgcctccactaacgtctctgcatctgatcgttttgca
gcctccaactttggtaaagaaagatttgtaaaactgctggaccagctacacaactcactg
aggatagacctctctacatacaggaataactttcctgctgggagccctgagcggcttcag
gatttaaagtctacagtggatttgctgaccagcattactttcttcaggatgaaggtgcaa
gaacttcagagccctccaagagccagccaggtggtaaaggactgtgtgaaagcctgcttg
aactctacatatgaatacatcttcaacaactgccatgacctctacagtcaccagtatcag
ctgcaggaacaacctctagaggaaccagggcccagcattcggaacttggatttctggccc
aaacttatcacactcattgtttcgatcatagaggaggataagaattcctacacacctgtt
ctgagccagtttcctcaggagttgaacgtaggaaaagtcagtgcagaagtgatgtggcat
ctgtttgctcaagacatgaaatatgcactggaggaacacgagaaagaccggctgtgtaag
agtgctgactacatgaacctgcacttcaaggtgaagtggctccacaatgaatatgtgcgc
gatctgcctgccctccaggggcaagtgcctgagtacccagcgtggtttgagcagtttgtg
ctacagtggctagatgagaatgaagatgtgtcactggaattccttcgtggggccttggaa
cgagataagaaggatgggttccagcagacatcagagcatgccttgttttcctgttctgtg
gtggatgtctttacacaactcaaccagagctttgagatcatccggaagttggaatgtcca
gaccccaacatccttgcccactacatgagaaggtttgctaagaccattgggaaagtgctg
atgcagtatgcagacatcttatcaaagaacttcccagcttactgcacaaaggagagactg
ccctgtatcctgatgaacaacatgcagcaactgagggtccagctggagaaaatgtttgag
gccatgggaggcaaagagctggactccgaagctgcagacagtctgaaggagctgcaggtg
aaactgaatacagttctggatgagcttagcatggtgtttggaaacagcttccaggtgcgg
attgatgaatgtgttcgacaaatggctgacatcctgggccaagttcggggcacagggaat
gcatcccctaacgccagggcctcggtggctcaggatgcagatagtgtgctgcgacctctc
atggacttcctggatggcaacctcacgctgtttgccactgtgtgtgagaagacagttctg
aagcgggtcctgaaggagctctggcgggtggtgatgaacaccatggagcgggttattgtc
ctgcccccactcactgaccagacgggcacccagctgatcttaactgctgccaaggagctg
agccagctttccaaactcaaggaccacatggtacgggaggaaacacggaatctcactcca
aagcagtgtgctgtcctcgacttggccttggacaccatcaagcaatacttccatgcagga
ggcaatggtctgaagaaaaccttcctggaaaagagcccagacctgcagtctctgcgttat
gccctctctctgtatacacagactacagacactctcatcaagacatttgtgcgctcacag
actgcccagggggctggtgtggatgaccccgtgggagaagtctctattcaggtggactta
tttacacatcctggcactggggagcataaggtcacagtgaaagtggtagcagccaatgac
ctcaagtggcagacagcgggtatgttccggccttttgtggaagtgaccatggttggccca
caccaaagtgataagaagaggaagttcacaaccaagtctaaaagtaacaactggactccc
aagtacaacgagacgtttcacttcctcctgggaaatgaagagggtccagaggcctatgaa
ttgcagatctgtgtgaaggattactgctttgcccgggaggatcgtgtgataggactggca
gtgatgcccctgagggatgtggcagctaagggcagctgtgcctgctggtgcccactgggc
cggaagatccatatggatgagacaggcatgaccattctccggattctgtctcagaggagc
aatgacgaggtagcccgagagttcgtgaagctcaaatcagagtctcgatccacagaggaa
gggagctga

DBGET integrated database retrieval system