KEGG   Mus musculus (mouse): 223255Help
Entry
223255            CDS       T01002                                 

Gene name
Stk24, 1810013H02Rik, C76483, MST-3, Mst3, STE20
Definition
(RefSeq) serine/threonine kinase 24 (EC:2.7.11.1)
  KO
K08838  
serine/threonine-protein kinase 24/25/MST4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     223255 (Stk24)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   223255 (Stk24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 E5; 14 64.95 cM
AA seq 431 aa AA seqDB search
MAHSPVQSGLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEA
EDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDEIQ
IATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFV
GTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLE
GNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFIIRNAKKTSYLTELIDRYKRWKAEQSH
EDSSSEDSDVETDGQASGGSDSGDWIFTIREKDPKNLENGTLQLSDLERNKMKDIPKRPF
SQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQR
YSLSGGGASAH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcccactccccggtgcagtcgggcctgccgggcatgcagaacctgaaagcagaccca
gaagagctttttaccaagctagagaagattggaaagggctcttttggtgaagtgttcaaa
ggcattgacaatcggactcagaaagtggtggccataaaaatcattgatctggaagaagcc
gaggacgagatagaggacatccaacaagagatcacagtgctgagccagtgtgacagtccc
tacgtcaccaagtactatggatcctatctcaaggatactaagttgtggataatcatggag
tatcttggtggaggctctgccctggatctgttagagcctggccctttagatgaaattcag
attgcaaccatattacgagaaattctgaaaggacttgattatctacactcggagaagaaa
attcacagagatattaaagcggccaatgttctgctctctgaacatggagaggtgaagctg
gcagactttggagtggccggccagctgacggatacccagatcaaaaggaacaccttcgtg
ggtacccccttctggatggcgccggaggtcatcaagcagtcagcctacgactcaaaggca
gacatctggtcccttggcatcaccgcaatagaactggccaaaggagagccaccacattct
gagctgcaccccatgaaggtgttattcctcatcccaaagaacaaccctcccacactggaa
gggaactacagcaaacccctcaaggagttcgtggaggcctgcctgaacaaggagcccagc
tttaggcccactgctaaggaattattgaagcacaaattcataatccgcaatgcaaagaaa
acgtcctacttgaccgagcttatcgacaggtacaagaggtggaaggcggagcagagccac
gaggactccagctcggaggactctgacgtggagacagatggccaggcgtctggaggcagc
gactctggggactggatcttcactatccgggagaaagatcccaagaatctggagaacgga
actcttcagctctcggacttggaaagaaataagatgaaagatatcccaaagaggcctttc
tctcagtgtttatccacaatcatttctcctctgtttgcggagctgaaagagaagagccag
gcatgcggagggaacttggggtcaatagaagagctgcggggagccatctacttggcggaa
gaggcctgccctgggatctcagacactatggtggcacagcttgtgcagcggctgcagaga
tattctctgagtggcggaggagcctcagcgcactga

DBGET integrated database retrieval system