KEGG   Mus musculus (mouse): 236733Help
Entry
236733            CDS       T01002                                 

Gene name
Usp11, 6230415D12Rik, mKIAA4085
Definition
ubiquitin specific peptidase 11 (EC:3.4.19.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     236733 (Usp11)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   236733 (Usp11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X A1.3; X
AA seq 921 aa AA seqDB search
MAAVAADPAAAAVPASAEDRDTQPEAMPDLDEQWRQIGNGRERPLRAGESWFLVEKHWYK
QWEVYVKGGDQDASTFPGCINNAGLFEDQISWHLRERLLEGDDYVLLPAPAWNYMVSWYG
LMDGQPPIERKVIELPGIRKVEVYPLELLLVQHSDMETALTIQFSYTDSVELVLQTAREQ
FLVEPQEDTRLWTKNSEGSLDRLCNTQITLLDACLETGQLVIMETRNKDGTWPSAQLCGM
NNIPDEDEDFQGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNRYLEELNFRNPL
GMKGELAEAYADLVKQTWSGYHRSIVPNVFKNKVGHFASQFLGYQQHDSQELLSFLLDGL
HEDLNRVKKKEYVELCNGAGRPDLEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCG
NVSVTFDPFCYLSVPLPVCSRRVLEVFFVPMDPRRKPEQHRVVVPKKGNISDLCVALSTH
TSVAPDKMIVADVFSHRFYKLYQLEDPLSGILDRDDIFVYEVTGRIEPVEGSRDDIVVPV
YLRERTPSRDYNNSYYGLILFGHPLLVSVPRDRFSWEGLYNILMYRLSRYVTKPTSDEDD
GDEKVDEDEDEDVEDDSSSEEEKEEMSAPTVNDGTREAEQEQAGTSSGVTERCPSLLDNS
LRASQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEMQTQPYIAMDWEPDMKRRYYDEVEA
EGYVKHDCVGYMLKKSPVQLKECIKLFTTVETLEKENPWYCSSCKQHQLATKKLDLWMLP
EVLIIHLKRFSFSKISREKLDTLVQFPIRDLDFSEFVIKPKNESSPDLYKYDLIAVSNHY
GGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVGRRQSQTSS
SDTPASPVSSSTPNSDIMDIN
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtcgcagcggacccagctgcagctgccgtcccggcctctgctgaggaccga
gacacacagcccgaggcaatgccagacctggatgaacagtggcgccaaatcgggaatggg
cgagagcgtccactgcgagctggcgaaagctggttccttgtggagaaacactggtataaa
cagtgggaggtgtacgtgaagggaggggatcaagatgctagcacctttcctggctgtatc
aacaatgctgggctctttgaagatcagataagctggcatctcagggagagactgctagaa
ggagatgattatgtgctgctcccagcgcctgcttggaactacatggtcagctggtatggc
ttaatggatggccagccacctattgagcgcaaggtaatagaacttcctggcattcggaag
gtggaagtgtacccactagagctactgctcgttcagcacagtgatatggaaacagctctc
accattcagtttagctatactgattctgtggaactagtcttgcaaacagctcgggagcag
tttctggtagagcctcaggaagacacgcgcctctggaccaagaactcagagggctctttg
gatcgactgtgtaatacacagatcacgctgcttgatgcctgccttgagactgggcagttg
gtcatcatggagactcgaaacaaagatggcacttggcccagtgctcagctgtgtggcatg
aacaacataccggacgaggatgaggacttccaggggcaaccgggcatctgtggccttacc
aatctgggcaacacatgcttcatgaactcggccctacagtgcctgagcaatgtgccacag
ctgacagagtactttctcaacaatcgctacctagaggagctcaacttccggaaccctcta
ggcatgaagggtgagcttgctgaggcctatgcagatctggtaaagcagacttggtctggc
taccaccgctccattgtgccaaatgtgttcaagaacaaggttggccattttgcatcccag
tttctgggctaccagcagcatgactcacaggaactactgtcattcctcctggatgggcta
catgaggatctcaatcgggtcaaaaagaaagaatatgttgagctatgcaatggtgctggg
cggcctgatctggaagtggctcaggaagcctggcagaaccataaacgacgaaatgattct
gtgatcgtggacactttccatggcctcttcaagtccaccctggtgtgccctgattgtggc
aatgtttctgtgacctttgaccccttctgctacctcagtgtcccactgcctgtctgctcc
aggagggtcttggaagtcttctttgtccccatggatccccgccgcaagccagaacagcac
cgggttgtagtccccaagaagggcaatatctcagatctgtgtgtggctctgtccacgcat
acaagtgttgcaccagacaagatgatagtagctgatgtcttcagtcaccgattctataag
ctttaccagctggaggatcctctgagtggcatcttggatcgtgatgatatctttgtatat
gaggtgactggtcggattgagccggttgagggttcaagagatgatattgtggtacctgtt
tacttgcgggagcgcaccccatccagagactacaacaactcctactatggtctgatactt
tttgggcaccctctcctggtgtcagtgccccgggaccggttctcctgggagggcctatat
aacatcttgatgtaccgactttcacgatatgtgaccaaacccacctcagatgaggatgat
ggggatgagaaagttgatgaagatgaggatgaggatgtggaagatgacagcagcagtgag
gaggaaaaggaggaaatgtctgcgcccactgttaatgatgggacccgagaagcagagcag
gagcaggctgggaccagctctggggtcactgagagatgcccatccctcttagacaacagc
ctccgcgcatcgcagtggcccccaaggcgacgacgaaagcagctgtttactctgcagacg
gtgaactccaatggaaccagtgaccggaccacttcccctgaagaaatgcaaacccagcca
tacattgccatggattgggaaccagatatgaagaggcgttattatgacgaagtggaggct
gagggctatgtgaagcatgactgtgtgggctacatgctgaagaaaagtccagtgcagctg
aaggagtgcatcaaactcttcaccactgtggaaaccctggagaaggagaacccctggtac
tgctcctcctgcaagcagcaccagctggccaccaagaaactggacctctggatgctaccc
gaagttctcattatccacctgaagcgtttttcattttccaaaatttcccgggagaagctg
gacaccctggtgcagtttcctatccgggacctggatttctctgagtttgtcatcaaacca
aagaatgagtcttctccagacctctacaaatatgatctcatcgcagtttccaaccattat
ggtggcatgcgtgatggacactatacaacatttgcctgcaacaaggacagtggccagtgg
cactactttgatgacaatagtgtctcacctgtgaatgagaatcagattgagtccaaggca
gcctatgtcttgttctatcagcgccaagatgtgggtcgacgccagtcccagacttcttca
tctgacactcctgcctctcctgtctccagttctacacccaactctgacatcatggatatc
aactaa

DBGET integrated database retrieval system