KEGG   Mus musculus (mouse): 23880Help
Entry
23880             CDS       T01002                                 

Gene name
Fyb, ADAP, B630013F22Rik, FYB-120/130, Slap130, p120/130, p120/p130
Definition
(RefSeq) FYN binding protein
  KO
K17698  
FYN binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    23880 (Fyb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
15; 15 A1
AA seq 819 aa AA seqDB search
MAKFNTGSNPTEEAATSSRPFKVAGQSSPSGIQSRKNLFDNQGNASPPAGPSSMPKFGTT
KPPLAAKPTYEEKPEKEPKPPFLKPTGGSPRFGTQPNSVSRDPEVKVGFLKPVSPKPTSL
TKEDSKPVVLRPPGNKLHNLNQESDLKTPGPKPGPAPPVPENELKPGFSKVAGAKSKFMP
AAQDTDSKPRFPRHTFGQKPSLSTEDSQEENTSKNVPVQKGSPVQLGAKSKGAPFKPPKE
DPEDKDHGAPSSPFPGVVLKPAASRGSPGLSKNFEEKKEDRKTDLAKNIFLNKLNQEEPA
RFPKAPSKLTAGTPWGQSQEKEGDKNSATPKQKALPPLSVLGPPPPKPNRPPNVDLTRFR
KADSANSATKSQTPYSTTSLPPPPPTHPASQPPLPASHPAHPPVPSLPPRNIKPPLDLKH
PINDENQDGVMHSDGTGNLEEEQESEGETYEDIDSSKERDKKREKEEKKRLELERKEQKE
REKKEQELKKKFKLTGPIQVIHHAKACCDVKGGKNELSFKQGEDIEIIRITDNPEGKWLG
RTARGSYGYIKTTAVEIDYDSLKRKKNSLNAVPPRLVEDDQDVYDDVAEQDAPNSHGQSG
SGGMFPPPPTDDEIYDGIEEEDDDDGSVPQVDEKTNAWSWGILKMLKGKDDRKKSIREKP
KVSESDNNEGSSLPSQHKQLDVGEEVYDDVDASDFPPPPAEMSQGMSVGRAKTEEKDPKK
LKKQEKEEKDLRKKFKYDGEIRVLYSTKVASSLTSKKWGARDLQIKPGESLEVIQSTDDT
KVLCRNEEGKYGYVLRSYLVDNDGEIYDDIADGCIYDND
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagttcaacacggggagtaacccgacagaggaggccgccaccagcagcaggccc
ttcaaagttgcaggacaaagctcgccttctggaatacaatcaagaaagaatttatttgac
aaccaaggaaatgccagcccgcccgcaggacccagcagcatgcctaaatttgggaccaca
aaaccacccttggcagcgaaacctacctacgaggagaagcctgagaaggaacctaaaccc
ccgtttttaaaacctactggagggagcccaagatttggaacacagccaaactcagtttct
agagaccctgaggtcaaagtggggttcctgaaacctgtaagccccaaacccaccagcttg
accaaagaagattccaaacctgtggttttacggccacctgggaataaacttcacaatttg
aaccaagagtctgacttaaagacgccaggaccgaagccagggcccgctcccccagtccca
gaaaacgaactgaagccaggattctcaaaggtagctggagctaagagcaagttcatgcca
gcggcacaagatactgactccaaaccccgatttcccagacacacctttggccagaagcca
tccctaagcacagaggactcccaggaagagaacacttctaagaacgtgcctgtccagaaa
ggatccccagtgcagttgggcgccaagtccaagggcgcccctttcaaaccacctaaggaa
gacccagaggataaagaccatggagcaccaagttcaccctttcctggagtggttctgaaa
cctgctgcgagcagagggagcccgggtctctccaaaaactttgaagaaaaaaaagaagat
aggaaaacagaccttgcaaagaacatctttctgaacaaactgaatcaagaagagccggcc
agattccctaaggccccttccaagctgacagcggggacaccgtggggccaaagtcaggag
aaagaaggagacaagaattctgcaaccccgaagcagaaggccctgccacccctgtccgtc
ttgggcccgcctccacccaagcccaacagaccacccaacgttgacctgaccagattccga
aaggctgactctgcaaacagtgccaccaaaagccagacaccttactcgacaacttccctg
ccaccacctccgcctacacatccagccagccagccacctctgccagcgtctcacccagcg
catccgccagtccccagcctgccccccagaaacatcaaacctccccttgacctgaaacat
cctataaatgacgaaaatcaagatggtgtcatgcactctgatggtactggaaatctagaa
gaggaacaagagagtgaaggggaaacatacgaagacatagattcatctaaggaacgagac
aagaaacgggaaaaagaagaaaagaagaggttggaactagaacgaaaggagcagaaggag
agagagaagaaagagcaagaactgaagaagaaattcaagctcacgggccccattcaagtc
atccaccatgcaaaagcctgctgcgatgtcaaaggaggaaagaatgagctgagcttcaaa
caaggagaggacattgagattatccgcatcacagacaacccagaaggaaaatggctgggc
aggactgcaagggggtcatatggttatattaaaacaactgccgtggagattgactatgat
tcgctgaaacggaagaagaactccctcaatgctgtcccaccaagacttgttgaagatgac
caggatgtctatgatgatgtggctgagcaggatgcccctaacagccacggtcagagcgga
agtggagggatgttccccccgccaccaacagacgacgagatctatgacggaatagaggag
gaagatgatgacgatggatccgtgccacaggttgacgagaagactaacgcatggtcctgg
gggattttgaagatgttaaagggaaaagatgacagaaagaaaagcattcgagagaaacct
aaagtctctgaatcagacaataatgaaggttcatctctcccttctcagcataagcaactg
gatgtgggagaagaagtttacgatgatgtggatgcctcagacttccctcctccacctgca
gagatgagtcaaggaatgagtgttggaagggcaaaaacggaagagaaagatcccaagaag
ctaaaaaagcaagaaaaggaagaaaaagacctcaggaaaaaatttaagtacgacggtgaa
attcgagttctatattcaactaaagttgcgtcctccttaacctctaaaaagtggggagcg
agagatctgcagataaaacctggggagtcactcgaagttatacaaagcacagatgacacc
aaagttctctgcaggaatgaagagggcaaatatggttatgtccttcggagttacctggtg
gacaatgatggagaaatctatgacgacatcgctgatggttgcatctatgacaatgactag

DBGET integrated database retrieval system