KEGG   Mus musculus (mouse): 240444Help
Entry
240444            CDS       T01002                                 

Gene name
Kcng2, AA591524
Definition
(RefSeq) potassium voltage-gated channel, subfamily G, member 2
  KO
K04901  
potassium voltage-gated channel subfamily G member 2
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNG, Kv6.x
   240444 (Kcng2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18; 18 E3
AA seq 480 aa AA seqDB search
MARLLGHPEAPDAEPGSAGRRGRGGRGARARHVIINVGGCRVRLAWAALARCPLARLERL
RACRGHDELLRVCDDYDVSRDEFFFDRSPCAFRAIVALLRAGKLRLLRGPCALAFRDELA
YWGIDEARLERCCLRRLRRREEEAAEASAAQPARGPPTSPGRALGSGRLERGRQRLRDVV
ENPHSGLAGRLFAYVSVAFVAVTAVGLCLSTMPDVRAEEERGECSTKCRNLFVLETVCVA
WFSFEFLLRSLQAESKCAFLRTPLAIIDILAILPFYVSLLAGLAAGPTGSKMLERAGLVL
RLLRALRVLYVMRLARHSLGLRSLGLTVRRCAREFGLLLLFLCVAMALFAPLVHLAEREL
GAHRDFSSVPASYWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHT
FSRSYSELKEQQQRAASPEPALREDSTRDDSTRSASATEDSSQDPETAGAAGSLPGRVGP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctcctggggcacccggaggcccccgacgcggagcctggcagcgcaggccga
cggggccgtggcggccgcggggcccgggcgcgccacgtcattatcaacgtcgggggctgc
agggtgcgtctggcctgggccgcgctggcccgctgtcccctggcgcgcctcgagcgcctg
cgagcctgccgcggccacgacgagctgctgcgcgtgtgtgacgactacgacgtgagccgc
gacgagttcttcttcgaccgcagcccgtgcgctttccgcgccatcgtggcgctgctgcgc
gccggcaagctaaggctgctgcgcggcccgtgcgccctggccttccgcgacgagctggcc
tactggggcatcgacgaggcgcggctggagcgctgctgcctgcgccgcctgcgccgccgc
gaggaggaggccgccgaggccagcgccgcgcagcccgcccgagggccgccgaccagcccc
ggccgagccctgggcagcgggcggctggagcgaggccgacagcgcctgcgcgacgtggtg
gagaacccgcactccgggctggcgggcaggctcttcgcctacgtctccgtggccttcgtg
gccgtcacagccgtcggcctgtgcctgagcaccatgccggacgtccgcgcagaagaggaa
cggggcgagtgctccacaaagtgccgcaacctgttcgtgctggagacggtgtgcgtggcc
tggttctccttcgagttcctgctgcgctccctgcaggctgagagcaagtgcgccttcctc
cggacgccgcttgccatcatcgacatcctggccatcctgcccttctacgtgtcgctgctc
gcgggactggcggcagggcccacgggcagcaagatgctggagcgcgcgggtctggtgctg
cggctgctgcgggcgctgcgcgtgctctacgtgatgcgcctggcgcgccactcgttgggg
ctgcgctcgcttggcctcaccgtgcgccgctgcgcacgcgagttcggactgctgctgctc
ttcctctgcgtggccatggcgctcttcgcgccgctcgtgcacctggctgagcgcgagctg
ggcgctcaccgcgacttctccagcgtccccgccagctactggtgggcagtcatctccatg
accaccgtgggctatggagacatggtgccgcgcagccttccgggccaggtggtggcgctg
agcagcatcctcagcggcatcctgctcatggccttccctgtcacctccatcttccacacc
ttctcgcgctcctattcggagctcaaggagcagcaacagcgcgcggccagccctgaaccg
gccctgcgcgaggacagcacgcgtgatgacagtacacgttcggccagcgccactgaggac
agctctcaggaccctgagaccgcaggcgcggcagggagcttgccgggccgggtgggaccc
tga

DBGET integrated database retrieval system