KEGG   Mus musculus (mouse): 242093Help
Entry
242093            CDS       T01002                                 

Gene name
Rxfp4, GPCR142, Gpr100, Rln3r2, SALPR
Definition
(RefSeq) relaxin family peptide receptor 4
  KO
K08398  
relaxin family peptide receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    242093 (Rxfp4)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Pancreatic peptide
   Relaxin
    242093 (Rxfp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 F1
AA seq 414 aa AA seqDB search
MATSNSSASLPTLFWVNGSGDSVLSTDGAAMPVQFLVLRIMVALAYGLVGIIGLLGNLAV
LWVLGNCGQRVPGLSSDTFVFSLALADLGLALTLPFWATESAMDFHWPFGSALCKVVLTT
TVLSIYASTFLITALSIARYWVVAMAVGPGSHLSVFWARVVTLAVWVAAALVTVPTAIFG
AEVELWGVCLCLLRFPSRYWLGAYQLQRVVLAFIVPLGVITTSYLLLLAFLERQQRCRPR
QWQDSRVVARSVRVLVASFALCWVPNHVVTLWEILVRFDLVPWDSTFYTFHTYILPITTC
LAHSNSCLNPVIYCLLRREPQQVLVSSFRALWSRLWPQRKACMEQMALKEVGGRTVASTQ
ESGSSRTHTNTMEHLDEGCSLNTLLSETYQGQSPQILGRSSCSLSQAAVSPGEV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggccacatccaattcttctgcctctctgcccaccctcttctgggtcaatggctctgga
gacagcgtgctgagcactgacggtgctgccatgcctgtccagttccttgttctgaggatc
atggttgcactggcctatggacttgtaggtatcattggcttgctgggaaatttggccgta
ctgtgggttctaggtaactgtggtcagcgtgtgcccggcctgtcttctgatacctttgtc
ttcagcctggctctagcagacttggggctggcccttactctccctttctgggcaaccgag
tcagcaatggacttccactggcctttcggaagtgccctctgcaaggtagtcctgaccacc
accgtcctcagcatctatgccagcaccttcctaatcacagcactgagtatcgcgcgatac
tgggtggtagccatggctgtgggaccaggtagtcacctctcagtcttttgggcccgtgtg
gtcaccctggcagtgtgggtggcagctgccctggtgactgtgcccacagcaatctttggg
gctgaagttgagttgtggggcgtgtgcctctgtcttctgcgtttccccagcagatactgg
ctgggagcttaccagctacagagggtagttctggccttcatcgtgcccttgggagtcatt
accaccagttacctgctgctgttggcctttctagagcggcagcaaagatgcaggccacga
caatggcaggacagccgagtggtagcccgctctgtccgtgtcctggtggcttccttcgcc
ctctgctgggttcccaaccatgtagtcactctctgggaaattctggtaaggtttgacctg
gtgccctgggacagtactttctacacctttcatacttacatccttcccatcaccacctgc
ttggcccacagcaacagctgcctcaaccctgtgatctattgtctcctgcggcgggagccc
cagcaggttcttgtcagctccttcagagctctctggtcaagactgtggcctcaaaggaag
gcctgcatggaacaaatggccctcaaggaggtaggcgggagaacggtagccagcacccag
gagagtggctcttctaggacacacacaaacacaatggaacacctggatgaaggatgcagc
ctgaacactctcctttctgagacctatcaggggcagagcccacagattctagggaggagc
agctgctctctcagtcaggctgctgtgtccccaggagaagtctga

DBGET integrated database retrieval system