KEGG   Mus musculus (mouse): 26364Help
Entry
26364             CDS       T01002                                 

Gene name
Cd97, AA409984, TM7LN1
Definition
CD97 antigen
Orthology
K08446  
CD97 antigen
Organism
mmu  Mus musculus (mouse)
Brite
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   26364 (Cd97)
G protein-coupled receptors [BR:mmu04030]
 Class B. Secretin receptor family
  Other
   EMR1
    26364 (Cd97)
Cellular antigens [BR:mmu04090]
 Proteins
  26364 (Cd97)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 C2; 8 40.22 cM
AA seq 724 aa AA seqDB search
MRGVRCPGLLVVCILLSLSGAGTQKAESKNCAKWCPINSKCVSNRSCVCKPGFSSEKELI
TNPAESCEDINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQD
VDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRGPDTICQEPPFPTWTLLPTA
HSQTLLRFSVEVQNLLRDFNPATVNYTIQKLIEAVDKLLEDPMETETQQVAAQLLSNLEQ
SLRTLAQFLPKGPFTYTSPSNTELSLMVKEQDNKDVTTVHHGQTWMELDWAVTAGAKISE
NGSSVAGILSSPNMEKLLGNTPLNLEQRRASLEDFYGSPIPSVSLKLLSNINSVFLTNTN
TEKLASNVTFKFDFTSVESIEPRHELICAFWKAHNGNGYWDTDGCSMNGTGFCHCNHLTS
FAILMAQYHVQDPRLELITKVGLLLSLICLLLCILTFLLVKPIQSSRTMVHLHLCICLFL
GSIIFLVGVENEGGEVGLRCRLVAVMLHFCFLAAFCWMALEGVELYFLVVRVFQGQGLST
WQRCLIGYGVPLLIVAISMAVVKMDGYGHATYCWLDFRKQGFLWSFSGPVAFIIFCNAAI
FVITVWKLTKKFSEINPNMKKLRKARVLTITSIAQLLVLGCTWGFGLFLFNPHSTWLSYI
FTLLNCLQGLFLYVMLCLLNKKVREEYWKWACMVTGSKYTEFNSSTTGTGTSQTRALRSS
ESGM
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcgtcagatgccccggcctgcttgtggtgtgcattttactgagtctctcagga
gctggaacccagaaggcagagagtaagaactgtgccaagtggtgccctatcaactcaaaa
tgtgtcagtaacagaagctgtgtctgcaagcccggcttcagctcggagaaggaattgatc
actaaccctgcagagagctgtgaagacatcaacgagtgtttactacctggattttcctgt
ggagactttgccatgtgtaagaactcagaggggagttacacctgcgtctgtaacctggga
tataagctcctttctggtgcagaatcttttgttaacgagagtgagaatacatgtcaagat
gtggatgagtgcagctctgggcagcatcaatgtcacaattccaccgtctgcaaaaacacc
gtaggctcctacaagtgccactgccgtccaggttggaagccaacttctgggtccctccgt
ggtccagacaccatatgccaagagccaccgttccctacttggacactgctgcccacagcc
cacagtcagactctcttgagattctctgttgaagtccagaatctgctccgtgacttcaat
ccagccacggtcaactacaccatccagaaactcatcgaggctgtggacaagctgctggaa
gaccccatggagactgaaacccaacaagtagctgcccagttgctctcgaacctggaacaa
agccttcggaccttggctcagtttttacccaaaggccccttcacctacacgtccccttca
aatactgaactgtccctgatggtgaaggagcaagacaacaaagatgttaccacagtgcac
cacggccaaacttggatggagctggactgggctgtgacagctggagccaaaatctcagaa
aatggctcctcggtggcaggcatcctgtccagcccaaacatggaaaagctgctgggcaac
accccgctgaacttggagcagagaagggcctccttggaggacttctatggaagcccgatt
ccgagtgtctcacttaagcttctctcaaacatcaattctgtcttcctgaccaacacgaac
actgaaaagctcgcctcgaatgtcacgttcaagttcgactttacttctgtggagtcaatt
gagccacgtcatgagctgatatgtgccttctggaaagcccacaacgggaatgggtactgg
gacaccgacggctgctcaatgaatggcactggcttctgccactgcaaccacctgaccagc
tttgccatcctaatggctcagtaccatgtgcaggacccaaggctggaattgatcaccaag
gtggggctgttgttgtccctgatctgcctgctgctgtgcatcctgaccttcctgctggtg
aagcccatccagagctctcgaaccatggtgcacctgcacctgtgcatctgcctcttcctg
ggctcaatcatattcctggtcggcgtggagaatgaagggggtgaggtgggcctgcgctgc
cgcctggtggccgtgatgctgcatttctgcttcctggccgccttctgctggatggcactg
gagggcgtggagctctacttcctggtggtgcgtgtgttccagggccaaggcctgagtaca
tggcaacgctgcctgattggctacggggtgcccctcctcatcgtggccatctcaatggca
gttgtcaaaatggatggctatgggcatgcaacatactgctggctggactttaggaagcag
ggctttctctggagcttttcgggacccgtggccttcatcattttctgcaatgctgccatt
ttcgtgatcactgtctggaagctcacaaagaagttttctgaaatcaacccaaacatgaag
aagttaaggaaggcgagggtgctgaccatcacctccatcgcccagctccttgtgctgggc
tgcacctggggcttcggcctgttcctcttcaacccccatagcacatggctatcctacatc
tttaccctgctcaactgcctgcagggcctattcctctatgtgatgctctgcctgctcaac
aaaaaggtgagggaagagtactggaaatgggcctgcatggtcactgggagcaagtacaca
gagttcaactcttccacaacaggcactggcaccagccaaacacgggctctcaggtcctca
gaatcagggatgtga

DBGET integrated database retrieval system