KEGG   Mus musculus (mouse): 26364Help
Entry
26364             CDS       T01002                                 

Gene name
Cd97, AA409984, TM7LN1
Definition
CD97 antigen
Orthology
K08446  
CD97 antigen
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 C2; 8 40.22 cM
AA seq 724 aa AA seqDB search
MRGVRCPGLLVVCILLSLSGAGTQKAESKNCAKWCPINSKCVSNRSCVCKPGFSSEKELI
TNPAESCEDINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQD
VDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRGPDTICQEPPFPTWTLLPTA
HSQTLLRFSVEVQNLLRDFNPATVNYTIQKLIEAVDKLLEDPMETETQQVAAQLLSNLEQ
SLRTLAQFLPKGPFTYTSPSNTELSLMVKEQDNKDVTTVHHGQTWMELDWAVTAGAKISE
NGSSVAGILSSPNMEKLLGNTPLNLEQRRASLEDFYGSPIPSVSLKLLSNINSVFLTNTN
TEKLASNVTFKFDFTSVESIEPRHELICAFWKAHNGNGYWDTDGCSMNGTGFCHCNHLTS
FAILMAQYHVQDPRLELITKVGLLLSLICLLLCILTFLLVKPIQSSRTMVHLHLCICLFL
GSIIFLVGVENEGGEVGLRCRLVAVMLHFCFLAAFCWMALEGVELYFLVVRVFQGQGLST
WQRCLIGYGVPLLIVAISMAVVKMDGYGHATYCWLDFRKQGFLWSFSGPVAFIIFCNAAI
FVITVWKLTKKFSEINPNMKKLRKARVLTITSIAQLLVLGCTWGFGLFLFNPHSTWLSYI
FTLLNCLQGLFLYVMLCLLNKKVREEYWKWACMVTGSKYTEFNSSTTGTGTSQTRALRSS
ESGM
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcgtcagatgccccggcctgcttgtggtgtgcattttactgagtctctcagga
gctggaacccagaaggcagagagtaagaactgtgccaagtggtgccctatcaactcaaaa
tgtgtcagtaacagaagctgtgtctgcaagcccggcttcagctcggagaaggaattgatc
actaaccctgcagagagctgtgaagacatcaacgagtgtttactacctggattttcctgt
ggagactttgccatgtgtaagaactcagaggggagttacacctgcgtctgtaacctggga
tataagctcctttctggtgcagaatcttttgttaacgagagtgagaatacatgtcaagat
gtggatgagtgcagctctgggcagcatcaatgtcacaattccaccgtctgcaaaaacacc
gtaggctcctacaagtgccactgccgtccaggttggaagccaacttctgggtccctccgt
ggtccagacaccatatgccaagagccaccgttccctacttggacactgctgcccacagcc
cacagtcagactctcttgagattctctgttgaagtccagaatctgctccgtgacttcaat
ccagccacggtcaactacaccatccagaaactcatcgaggctgtggacaagctgctggaa
gaccccatggagactgaaacccaacaagtagctgcccagttgctctcgaacctggaacaa
agccttcggaccttggctcagtttttacccaaaggccccttcacctacacgtccccttca
aatactgaactgtccctgatggtgaaggagcaagacaacaaagatgttaccacagtgcac
cacggccaaacttggatggagctggactgggctgtgacagctggagccaaaatctcagaa
aatggctcctcggtggcaggcatcctgtccagcccaaacatggaaaagctgctgggcaac
accccgctgaacttggagcagagaagggcctccttggaggacttctatggaagcccgatt
ccgagtgtctcacttaagcttctctcaaacatcaattctgtcttcctgaccaacacgaac
actgaaaagctcgcctcgaatgtcacgttcaagttcgactttacttctgtggagtcaatt
gagccacgtcatgagctgatatgtgccttctggaaagcccacaacgggaatgggtactgg
gacaccgacggctgctcaatgaatggcactggcttctgccactgcaaccacctgaccagc
tttgccatcctaatggctcagtaccatgtgcaggacccaaggctggaattgatcaccaag
gtggggctgttgttgtccctgatctgcctgctgctgtgcatcctgaccttcctgctggtg
aagcccatccagagctctcgaaccatggtgcacctgcacctgtgcatctgcctcttcctg
ggctcaatcatattcctggtcggcgtggagaatgaagggggtgaggtgggcctgcgctgc
cgcctggtggccgtgatgctgcatttctgcttcctggccgccttctgctggatggcactg
gagggcgtggagctctacttcctggtggtgcgtgtgttccagggccaaggcctgagtaca
tggcaacgctgcctgattggctacggggtgcccctcctcatcgtggccatctcaatggca
gttgtcaaaatggatggctatgggcatgcaacatactgctggctggactttaggaagcag
ggctttctctggagcttttcgggacccgtggccttcatcattttctgcaatgctgccatt
ttcgtgatcactgtctggaagctcacaaagaagttttctgaaatcaacccaaacatgaag
aagttaaggaaggcgagggtgctgaccatcacctccatcgcccagctccttgtgctgggc
tgcacctggggcttcggcctgttcctcttcaacccccatagcacatggctatcctacatc
tttaccctgctcaactgcctgcagggcctattcctctatgtgatgctctgcctgctcaac
aaaaaggtgagggaagagtactggaaatgggcctgcatggtcactgggagcaagtacaca
gagttcaactcttccacaacaggcactggcaccagccaaacacgggctctcaggtcctca
gaatcagggatgtga

DBGET integrated database retrieval system