KEGG   Mus musculus (mouse): 26396Help
Entry
26396             CDS       T01002                                 

Gene name
Map2k2, AA589381, MEK2, MK2, Prkmk2
Definition
mitogen-activated protein kinase kinase 2 (EC:2.7.12.2)
Orthology
K04369  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Vascular smooth muscle contraction
VEGF signaling pathway
Gap junction
Toll-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Prion diseases
Hepatitis B
Influenza A
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    26396 (Map2k2)
   04015 Rap1 signaling pathway
    26396 (Map2k2)
   04010 MAPK signaling pathway
    26396 (Map2k2)
   04012 ErbB signaling pathway
    26396 (Map2k2)
   04370 VEGF signaling pathway
    26396 (Map2k2)
   04066 HIF-1 signaling pathway
    26396 (Map2k2)
   04068 FoxO signaling pathway
    26396 (Map2k2)
   04022 cGMP - PKG signaling pathway
    26396 (Map2k2)
   04151 PI3K-Akt signaling pathway
    26396 (Map2k2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    26396 (Map2k2)
  Cell communication
   04540 Gap junction
    26396 (Map2k2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    26396 (Map2k2)
   04650 Natural killer cell mediated cytotoxicity
    26396 (Map2k2)
   04660 T cell receptor signaling pathway
    26396 (Map2k2)
   04662 B cell receptor signaling pathway
    26396 (Map2k2)
   04664 Fc epsilon RI signaling pathway
    26396 (Map2k2)
  Endocrine system
   04910 Insulin signaling pathway
    26396 (Map2k2)
   04912 GnRH signaling pathway
    26396 (Map2k2)
   04915 Estrogen signaling pathway
    26396 (Map2k2)
   04917 Prolactin signaling pathway
    26396 (Map2k2)
   04921 Oxytocin signaling pathway
    26396 (Map2k2)
   04919 Thyroid hormone signaling pathway
    26396 (Map2k2)
   04916 Melanogenesis
    26396 (Map2k2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    26396 (Map2k2)
  Nervous system
   04720 Long-term potentiation
    26396 (Map2k2)
   04730 Long-term depression
    26396 (Map2k2)
   04722 Neurotrophin signaling pathway
    26396 (Map2k2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    26396 (Map2k2)
   05206 MicroRNAs in cancer
    26396 (Map2k2)
   05205 Proteoglycans in cancer
    26396 (Map2k2)
   05214 Glioma
    26396 (Map2k2)
   05216 Thyroid cancer
    26396 (Map2k2)
   05221 Acute myeloid leukemia
    26396 (Map2k2)
   05220 Chronic myeloid leukemia
    26396 (Map2k2)
   05218 Melanoma
    26396 (Map2k2)
   05211 Renal cell carcinoma
    26396 (Map2k2)
   05219 Bladder cancer
    26396 (Map2k2)
   05215 Prostate cancer
    26396 (Map2k2)
   05213 Endometrial cancer
    26396 (Map2k2)
   05223 Non-small cell lung cancer
    26396 (Map2k2)
  Neurodegenerative diseases
   05020 Prion diseases
    26396 (Map2k2)
  Infectious diseases
   05164 Influenza A
    26396 (Map2k2)
   05161 Hepatitis B
    26396 (Map2k2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26396 (Map2k2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   26396 (Map2k2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 C1; 10 39.72 cM
AA seq 401 aa AA seqDB search
MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELDLDEQQRKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRP
PGRPISVGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERAD
LKLLMNHAFIKRSEGEEVDFAGWLCRTLRLKQPSTPTRTAV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgttaccggcactcactatcaaccctaccatcgccgag
ggcccgtcccccaccagcgagggcgcctctgaggcaaacctggtggacctccagaagaag
ctggaagagctggacctggatgagcagcaaaggaagcggctggaggccttccttacccag
aaggctaaggtcggtgagctcaaggacgacgactttgagaggatctcagagctgggtgcc
ggcaatggcggagtggtcaccaaggcccggcataggccgtcaggcctcatcatggccaga
aagctgatccacctggagatcaaaccggccgtgcgcaaccagatcatccgggagctgcag
gtgctgcacgagtgcaactcgccctacatcgtgggcttctatggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggatggtggctcactggaccaggtactgaag
gaggccaagcggattcctgaagacatcttggggaaggtcagcattgcggtgctccggggc
ctggcctacctccgagagaagcaccagatcatgcacagagatgtgaagccctccaacatc
ctggtgaactctcgcggggagattaagctgtgtgacttcggggtgagcggccagctgatc
gactccatggccaactcgtttgtagggacgcgctcctacatgtccccagagcggctgcag
ggcacccactactctgtgcagtcggacatctggagcatggggctgtcgctggtggagctg
gccatcgggaggtatcccattcccccacctgatgccaaggaactagaggccagctttggc
cggcctgtggtggacggggcagacggagaaccccatagtgtctccccgaggcccaggccc
cctggacgccccatcagtgtaggtcatgggatggacagccgaccggccatggccatcttt
gagctgctggactacatagtgaacgagccacctcccaagctgcccagtggtgtgttcagc
tcagacttccaggagtttgtgaataaatgtctcattaagaacccagcagagcgagcagat
ctgaagctgctgatgaaccacgccttcatcaagcgctctgagggggaggaagtggacttc
gccggctggctgtgcagaaccctgcggctgaagcagcccagcacacccacgcggactgca
gtgtga

DBGET integrated database retrieval system