KEGG   Mus musculus (mouse): 269784Help
Entry
269784            CDS       T01002                                 

Gene name
Cntn4, 9630050B05, Axcam, BIG-2
Definition
(RefSeq) contactin 4
  KO
K06762  
contactin 4
Organism
mmu  Mus musculus (mouse)
Brite
Cell adhesion molecules and their ligands [BR:mmu04516]
 7. Others
  PTPRG; receptor-type tyrosine-protein phosphatase gamma [KO:K16667]
   269784 (Cntn4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6; 6 E2
AA seq 1026 aa AA seqDB search
MRLPWELLVLQSFMLCLADDYTLHGPVFVQEPSHVMFPLDSEEKKVKLSCEVKGNPKPHI
RWKINGTDVDIGMDFRYSVVDGSLLINNPNKTQDAGTYQCIATNSFGTIVSREAKLQFAY
LENFKTRTRSTVSVRRGQGMVLLCGPPPHSGELSYAWIFNEYPSYQDNRRFVSQETGNLY
IAKVEKSDVGNYTCVVTNTVTNHKVLGPPTPLILRNDGVMGEYEPKIEVQFPETVPAEKG
TTVKLECFALGNPVPTILWRRADGKPIARKARRHKSNGILEIPNFQQEDAGSYECVAENS
RGKNVAKGQLTFYAQPNWVQIINDIHVAMEESVFWECKANGRPKPTYRWLKNGDPLLTRD
RIQIEQGTLNITIVNLSDAGMYQCVAENKHGVIFSSAELSVIAESPDFSRTLLKRVTLVK
VGGEVVIECKPKASPRPVYTWRKGREILRENERITISEDGNLRIINVTKSDAGSYTCIAT
NHFGTASSTGNVIVKDPTKVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWTFNGHLI
DFDKDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDKLSVAADLIVRGPPGPP
EAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPFSVGWQAVNTVPDLVDGKTFTAT
VVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSKSELVITW
ETVPEELQNGRGFGYVVAFRPHGKMIWMLTVLASADASRYVFRNESVRPFSPFEVKVGVF
NNKGEGPFSPTTLVYSAEEEPTKPPASIFARSLSATDIEVFWASPIGKNRGRIQGYEVKY
WRHDDKEENAKKIRTVGNQTSTKITNLKGSALYHLSVKAYNSAGTGPSSATVNVTTRKPP
PSQPPGNIIWNSSDSKIILNWDQVKALDNESEVKGYKVLYRWNRQSSTSVIETNKTSVEL
SLPFDEDYIIEIKPFSDGGDGSSSEQIRIPKISNSYARGSGASTSNACTLSAISTIMISL
TARSSL
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgccatgggaactgctagtgctgcaatcattcatgttgtgccttgcagatgac
tacacactgcatggcccagtttttgttcaagaaccaagtcatgtcatgtttcctttggat
tctgaggagaaaaaagtgaaactcagttgtgaagttaaagggaatccaaaacctcacatc
aggtggaagataaatggaacagatgttgacattggtatggatttccgctacagtgttgtt
gacggcagcttgttgatcaataaccccaataaaacccaagatgctggaacgtaccagtgc
atagcaacaaactcatttggaacaattgtaagcagagaagcaaagcttcagtttgcttat
cttgaaaactttaagacaagaacaagaagcactgtgtcagtccgtcgaggtcagggaatg
gtccttctgtgcggcccgccaccccattctggagagctgagctatgcctggatcttcaat
gaatacccttcctatcaggataaccgccgcttcgtttctcaagagactgggaatctgtat
attgccaaagtggaaaaatctgatgttggtaattacacctgtgtagttaccaacactgtg
accaaccacaaggtcctgggaccgcccacaccactaatcctgagaaatgatggggtgatg
ggtgaatatgagcccaaaatagaagtacagtttccagaaaccgtcccggctgagaaagga
acaacagtcaaactggaatgctttgccttaggaaatccagtcccaactattctatggcga
agagctgatggcaagccaatagcaaggaaagccagaagacataagtcgaatggaattctg
gaaattcccaattttcagcaggaagatgccggttcatatgaatgtgtggctgaaaactcc
agaggcaaaaacgtagccaagggacagttgactttttatgctcaacctaactgggttcaa
ataataaatgatatccacgtggccatggaagagagtgtcttctgggaatgtaaagcaaat
gggaggcctaaacctacctacagatggctaaaaaatggtgacccactgttaacacgggat
agaatacaaatcgagcaaggaacactcaacataacaatagtgaatctctcagatgctggc
atgtaccagtgtgtggcagaaaataaacatggagttatcttttccagcgctgagcttagt
gtaatagctgaaagtccagatttttcccgaacactcttaaaaagagtaacacttgtcaaa
gtgggaggtgaagttgtcattgagtgcaagccaaaagcatccccaagacctgtctacacc
tggagaaagggaagagaaatattaagagaaaatgaaagaattaccatttctgaagatggg
aacctcagaatcatcaatgtgactaaatctgatgctggaagttacacctgcatagccacg
aaccattttggaactgccagcagtactgggaatgtgattgtgaaagacccaacaaaggtg
atggttcctccttccagcatggatgtcactgtaggagaaagcattgttcttccatgccag
gtaacacatgatcactccctggacattgtgtttacgtggacatttaatggacacttgata
gactttgacaaggatggagaccactttgaaagagttggagggcaggattcagctggtgat
ttgatgatccgaaacatccaactgaagcatgctgggaagtatgtctgcatggtccaaaca
agtgtagacaaactctctgttgctgcggacctgattgtaagaggtcctccaggtcctcct
gaggctgtgaccatagatgaaatcacagacaccactgctcagctttcttggagaccagga
cctgacaaccacagccccatcaccatgtatgttatccaagctaggactccattctccgtg
ggctggcaagcagtcaatacagttccagatctcgtcgacgggaagacattcacagcaact
gtggtgggtttgaatccttgggttgaatatgaattccgcactgttgcagctaatgtgatt
ggcattggggaacccagccggccctcagagaaacggaggacagaagaggctctccctgaa
gtcaccccggctaacgtcagtggtggtggaggcagcaaatctgaactggttataacctgg
gagacagtccctgaggaattacagaatggcagaggctttggttacgtggttgccttccgg
ccacatggcaaaatgatctggatgctgaccgtgctggcttcagctgatgcctccagatac
gtgttcaggaatgagagtgtgcgtccattctctccctttgaggttaaagtgggtgtcttc
aataacaaaggggaaggccctttcagtcccaccacgctggtgtattctgctgaagaagaa
cccaccaagccaccagccagtatctttgccaggagtctttctgccacggatatcgaagtt
ttctgggcctcccctattggaaagaacagaggacggattcaaggttatgaggtaaaatat
tggagacatgatgacaaggaagaaaatgctaaaaagatacgaacagttggaaatcagaca
tccacaaaaatcaccaacttgaaaggaagtgctctgtatcacttatctgtcaaggcgtat
aactcagctgggacaggaccctccagtgcaacagtcaatgtcacgaccagaaagccacca
ccaagccaaccccctggaaacatcatatggaattcatcggactccaaaattatcctgaac
tgggatcaagtgaaggccctggataatgagtcagaagtaaaaggatacaaagtcttgtac
agatggaacaggcaaagcagcacatctgtcattgaaaccaacaagacatcagtggagctt
tcattacctttcgatgaagattacatcatagagatcaagccattcagtgatggaggagat
ggcagcagcagtgagcaaatccgaatcccaaagatatcaaattcctatgcaagaggatcg
ggggcttctacctccaatgcgtgtacgctgtcagccatcagtacaataatgatttctctc
acagccaggtctagtttatga

DBGET integrated database retrieval system