KEGG   Mus musculus (mouse): 27206Help
Entry
27206             CDS       T01002                                 

Gene name
Nrk, AA407323, AA409510, AI225895, AV168563, AW538185, Nesk
Definition
(RefSeq) Nik related kinase (EC:2.7.11.1)
  KO
K16313  
Nik-related protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27206 (Nrk)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   27206 (Nrk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X F1; X 61.15 cM
AA seq 1455 aa AA seqDB search
MAGPGSWRDKEVTDLGQLPDPTGIFSLDKAIGLGTYGRIFLGIHEKTGSLVAVKVMSARK
TPLPEIGRRVRVNKYQKSVGWRYSDEEEDLRTELNLLRKYSFHKNIVTFYGAFFKLNPPG
HQHQLWMVMELCAAGSVTDVVRMTRNQSLKEDWIAYICREILQGLAHLHAHQVIHRDIKG
QNVLLTHDAEVKIVDFGVSAQVSRTNGRRNSFIGTPYWMAPEVIHCDEDPRCSYDYRSDV
WSVGITAIEMAEGAPPLCKLQPLEALCVILREAAPKVKSSGWSRKFQNFMENCMIKNFLF
RPTSGNMLLHPFVHDIKNERRVVESLTKHLTGIIQKREKKGIPVAFEGEEAAKEQYITRR
FRGPSCTPELLRVPTSSRCRPLRVLHGEPPQPRWLPDQEDPQDQELQQLQKAAGVFMPLH
SQDNTSKLFPKQVEVAPYLRGAAQVVMPVLVQVEAPPQVSKAAQMLKSLPTQDNKATSPE
VQAPVAEGQQAQHEALETEQPKDLDQVPEEFQGQDRAPEQPRQGQAAEQQQIHNPVPEQP
PEEDREPEQAEVQEEAVEPPQAEIEDKEPEVVQVHAQVLLPLLSQNRHVLLPLHLDRQLL
IPVGEQNEEVPRAQAWDLEASRAVGAVQALIEGLSRDLLRAPNAFVTKPLGPLQIFLENL
STDGFYTEPEPTQKKKSKVASLRKAIAKRLRPKRFRAKALWRLEDFEFSDVETSRRRRHR
RWEDIFNQHEEQLRRVENDREDDSSDNDEVFHSIQAEVQIEPHAANPAGNEVHERSAPMP
CNRNRTHRVKFSPSVGEEEPSLEEAQPQQQQQQPMNIRPRNCLNPQNFQAQSDSSSEEDS
PVTRRKSQSSPPYSTIDQKLLIDIHVPDGFKVGKISPPVYLTNEWVGYNALSEIFWDDWI
MPTRPARPPEEDGDYVELYDADANANGDEEVANGAYEDPRDGANGHDDMNNQLDQANGYE
GHGAAGYNGGDVGGNHGAAFNGPRANYPRAGILKNGHNDGRALNRGAFGVFGDNAARAFH
GAAGEAGAAFGNHGANRGNGRGNRNREANGRNEENGAFGRDQHVFPEFEHEESDRGTETS
DSIALEITSFDGEQNSGRPVSSTTMGFPIGRSSPRGSDFGSDISYNSPILHVYEKDFSSE
VYCGSLWGVNLLLGTQSHLYLMDRSGKAEIVKLIKRRPFRQIQVVEQLNLLITISGKKNR
LRVYHLSWLRNKILNNDPKSKKRQKAMRKKEEACKAIDKLIGCEHFSVLQHEETTYIAVA
VKSSIHLFAWAPKSFDENTAIKVFPTRDLKPLTVDLAVGSEKTLKIFFSSANGYHIIDAE
SEVMSEVTLPNNNVVILPDCLGLGVMLSLNAEAASEEANEQLLKKILDVWKDIPSSVAFE
CTKRITGWDQKAIEVRSLQSTILENELKRRSIKKLRFLCARGDKMFFASTLSNDHSRVYL
MSLGKLEELHRSYAV
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atggcaggacctgggagttggagggacaaggaggtgacagatcttggccagttgccggat
ccaactggaatattctcactagataaagccattggtcttggtacttatggaagaatcttt
ttgggaatccatgaaaagactggttcattggtggctgttaaagtaatgagtgccaggaag
actcctttgcctgagataggaagacgggtgagagtgaataaataccaaaagtctgttgga
tggagatacagcgatgaagaagaggatcttaggacggaactcaacctgctgaggaagtac
tctttccacaaaaacattgtgaccttctatggagcatttttcaagctgaatcctcctggc
catcagcaccaactttggatggtaatggagctatgtgcagcaggctcagtcactgatgta
gtgaggatgacaagaaatcagagtttaaaagaagactggatcgcttatatctgtcgagaa
atccttcagggcttagctcaccttcatgcacaccaagtaattcaccgggacatcaaagga
caaaatgtgctgctgactcatgatgctgaagtcaaaatagtggattttggagtgagtgcc
caagtgagcagaacaaatggacggagaaatagcttcattggtacaccgtactggatggcc
ccagaggtgattcattgtgatgaggacccaaggtgttcctatgattacagaagtgatgtg
tggtctgtgggaatcactgctattgaaatggctgaaggggctcctcctctgtgtaagctt
cagcctctggaagccctttgtgttattctacgggaagccgctcccaaagtcaaatccagt
ggatggtcccgtaagttccagaatttcatggaaaattgcatgataaaaaatttcctattt
cgtcctacatctggaaacatgcttcttcacccatttgtccatgatataaaaaatgaacga
cgtgttgtggagtccttgacaaaacatcttactgggatcattcaaaagagagagaaaaaa
ggaatacctgtggcctttgaaggagaagaagctgctaaggaacagtacatcacaaggaga
ttcagagggccttcttgcactcctgagcttctcagagtgccaaccagcagcagatgcaga
ccactcagagtcctgcatggagagccccctcagccaaggtggctacctgatcaagaagac
ccacaggaccaagaacttcaacaactgcagaaggcagccggagtgttcatgcctctacat
tctcaggacaatacatccaagcttttcccaaagcaggttgaggtagcaccctatctccgt
ggggcagctcaggtggtcatgccagtactggtacaggttgaagcaccgccccaagtaagc
aaagcagcccagatgctcaagtcactccccactcaggacaacaaagctacttctccagag
gtccaggcccccgtagccgaaggacagcaggcccagcatgaggccttagagacagaacag
cctaaagatttggaccaggtgccagaagaatttcaggggcaagacagggcacctgaacag
ccaaggcagggccaggctgctgagcagcagcagatacataatccggttcctgagcagccg
ccggaggaggatagggagcctgagcaagctgaggtgcaggaagaggctgtggagcctccc
caagctgagatcgaggacaaggaacctgaggtagtgcaagtgcacgcccaggtgctcctg
cctttactgtcccagaaccgtcacgtgctcttgcctcttcatttggatagacagctgctc
attccggtaggggaacaaaatgaagaggtaccacgagcccaggcctgggatctagaggcc
tcaagggcagttggtgcagtgcaagcgctgatcgagggactatccagggacttgcttcga
gcaccaaatgcatttgtcacaaaaccacttggtccgctgcagatcttcttggaaaatttg
tctacagacgggttttacactgagccggaaccgacacagaagaaaaagtcgaaagttgct
agtctaaggaaagcaatagcaaaacgactaagacccaagaggttcagagcaaaggcatta
tggcgacttgaagattttgaattctcagatgtagaaaccagcaggagacggcgccaccgt
agatgggaggacatctttaatcagcatgaagagcaactgagacgagttgaaaatgacaga
gaagatgactcatcagacaatgatgaagtgtttcattcaattcaggctgaagtccaaata
gaaccacacgctgcaaatcctgcaggaaatgaggtccatgagagatctgctcccatgcct
tgcaaccggaatcgcacacatcgtgtgaaattttctccaagtgttggtgaggaagagcct
tctttggaagaagcccagccgcagcagcagcagcagcagcccatgaacatccgaccgagg
aattgcctaaatcctcagaattttcaagctcaatcagactcatcttctgaggaggacagt
cctgtgactaggaggaagtcccagtcatcaccgccttattctactattgatcagaagcta
ctgattgatatccacgttccagatggatttaaagtggggaaaatatcacctcctgtgtac
ttgacaaatgaatgggtaggctataatgcactctctgaaatcttctgggatgactggata
atgcctacacgtcccgctcggccacctgaagaagatggtgattatgttgaactctatgat
gctgatgccaatgctaatggtgatgaagaagttgcaaacggtgcttatgaagatcctcgt
gatggtgccaatggccatgatgacatgaataaccagcttgatcaagcaaatggttatgaa
ggccatggtgctgctggctacaatggtggagacgttggtggtaatcatggtgctgctttc
aatgggccaagagcaaattatcccagagcgggaatcttgaaaaacggtcataatgatgga
cgtgctctaaacaggggagcttttggagtctttggagacaatgcagccagagctttccat
ggagctgccggtgaagcaggtgcagcctttggaaaccatggagccaataggggcaatgga
agaggtaacagaaacagggaggccaatggaaggaatgaagagaatggagcatttggacgg
gatcaacatgtatttccagagtttgaacatgaggaatcagatcgtggaactgagacctca
gattcaattgccttggagatcacatcctttgatggtgagcaaaacagtggtagaccagta
tcatcaacaacaatgggttttcctattggacgctcatctcctagaggttctgattttggg
agtgacatctcatataacagcccaatactacatgtgtatgaaaaggatttctcatctgag
gtctactgtggttctttgtggggagtcaatttgttgctgggcacccaatctcatctgtat
ctgatggaccgaagtggaaaggcagaaattgttaaacttataaagcgaagaccattccgg
cagattcaagtcgtggagcagctcaatttgctgattaccatctctggcaaaaagaacaga
cttcgcgtgtatcatctgtcttggctgaggaacaaaattctgaataatgatccaaagagt
aagaaaaggcagaaggcgatgaggaagaaagaggaagcttgcaaagctatcgataagttg
attggctgtgaacacttcagtgtccttcaacatgaagaaacaacatacattgcggttgct
gtgaagtcatcaattcacctctttgcatgggcaccaaaatcctttgatgaaaacactgcc
attaaagtgtttccaactcgtgatcttaagccactgacagttgacctggctgttggttca
gagaaaacactgaagattttcttcagctcagctaatggatatcatatcatcgatgcagaa
tctgaagttatgtctgaggtgaccttgccaaataataatgtcgtcattttacctgattgc
ttgggacttggtgtgatgctctccctcaatgctgaagctgcctccgaggaagcaaacgaa
caactccttaagaagatcctggacgtgtggaaggacataccgtcttctgtggcttttgag
tgtacaaagagaatcactggatgggaccaaaaggctattgaagtgcgctctcttcagtca
actattctcgagaatgagctgaagcgccgctcaatcaagaaactgagatttctctgtgcc
cgtggtgacaagatgttctttgcttctacactgagcaatgaccacagccgggtttacctt
atgagccttggaaaacttgaagagctccatagaagctatgctgtttaa

DBGET integrated database retrieval system