KEGG   Mus musculus (mouse): 319164Help
Entry
319164            CDS       T01002                                 

Gene name
Hist1h2ac
Definition
(RefSeq) histone cluster 1, H2ac
  KO
K11251  histone H2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu05034  Alcoholism
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    319164 (Hist1h2ac)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    319164 (Hist1h2ac)
  Substance dependence
   05034 Alcoholism
    319164 (Hist1h2ac)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    319164 (Hist1h2ac)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319164 (Hist1h2ac)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 319164
NCBI-ProteinID: NP_835496
MGI: 2448287
Ensembl: ENSMUSG00000069270
Vega: OTTMUSG00000000565
UniProt: C0HKE1 C0HKE2 C0HKE3 C0HKE4 C0HKE5 C0HKE6 C0HKE7 C0HKE8 C0HKE9 B2RVF0
Structure
PDB: 

Jmol
Position
13; 13 A3.1
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacgtggtaagcagggcggcaaggctcgcgccaaggccaagacccgctcctcc
cgggccggcctgcagttccccgtgggccgcgtgcaccggctgctccgcaagggtaactac
tcggagcgcgtgggcgccggcgccccggtctacctggcggccgtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
accgagagccaccacaaggccaaggggaaataa

DBGET integrated database retrieval system