KEGG   Mus musculus (mouse): 319164Help
Entry
319164            CDS       T01002                                 

Gene name
Hist1h2ac
Definition
(RefSeq) histone cluster 1, H2ac
  KO
K11251  
histone H2A
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    319164 (Hist1h2ac)
  Substance dependence
   05034 Alcoholism
    319164 (Hist1h2ac)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    319164 (Hist1h2ac)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   319164 (Hist1h2ac)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13; 13 A2-A3
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacgtggtaagcagggcggcaaggctcgcgccaaggccaagacccgctcctcc
cgggccggcctgcagttccccgtgggccgcgtgcaccggctgctccgcaagggtaactac
tcggagcgcgtgggcgccggcgccccggtctacctggcggccgtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
accgagagccaccacaaggccaaggggaaataa

DBGET integrated database retrieval system