KEGG   Mus musculus (mouse): 381835Help
Entry
381835            CDS       T01002                                 

Gene name
Sbk3, Gm1078, Sgk110
Definition
(RefSeq) SH3 domain binding kinase family, member 3 (EC:2.7.11.1)
  KO
K08858  
serine/threonine-protein kinase SBK [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     381835 (Sbk3)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  NKF1 family
   381835 (Sbk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 A1
AA seq 342 aa AA seqDB search
MALQRLVELTASRVTSVRSLCVQYRLIRKLGSGSYGRVLLAQPRQGGQTVALKLLRRDSV
LRTTFLREFCVGRCVSSHPGLLQTLGRPLQTPRYFAFAQEFAPCGDLSGMLQEKGLPELM
VKRIVAQLAGALDFLHGRGLVHADVKPDNVLVFDPDCNRVALGDLGLTRPEGSPTPAPPV
PLPTAPPELCLLLPPNTLPLRPAVDSWALGVLLFCAATACFPWDVALAPDPEFEAFAGWM
TTKPQPPRPPAPWDQFAPPALTLLQGLLDLDPETRSPPLAVFDVLGDNWGLQGSGEGSGS
LGVIPYKDGEEEEGGSSLEEWTDEEEDEIKDSGGMEADNRAS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcagcggctagtggagctaacagccagccgagtgacatcagtaagaagcctg
tgtgtacagtaccgtctcatccgaaagctaggttccggctcctatggccgcgtgctccta
gcccagccacgccaaggaggtcaaactgtggcccttaagctcctccgaagggactcagtc
ctgagaacaacgttcctgagagaattctgtgtgggccgctgcgtctcttcacatccaggc
ctactacagaccctgggaaggcccctacagacacctcgatattttgcctttgctcaggag
tttgcaccctgtggggatctcagtggaatgctccaggagaagggcctcccagagctgatg
gtgaagcggatagtggcccagctggctggagccctggacttcctccatggccgggggcta
gtgcatgcagatgtcaagccagacaatgtgctagtcttcgaccctgactgtaacagagta
gccctgggtgacctgggtttgactcgacctgaaggcagcccaacccctgctcccccagtg
cctctgcccactgcaccacctgaactctgcctcctgctgccaccaaacacactgcccctg
aggccagctgtggactcctgggcactgggtgtgcttctcttctgtgctgccacggcctgc
ttcccttgggatgtagcattggctcctgatcctgagtttgaggcctttgctggttggatg
accactaagccccagccccctcggccaccagcaccctgggaccagtttgcacccccagct
ctgaccttgctccagggacttctggacctggatcctgagactaggagtcctccactagct
gtctttgatgttttaggggacaactgggggctccagggtagtggagagggatccggaagc
ttgggggttataccctacaaagatggggaggaagaagagggaggatcaagtttggaggag
tggaccgacgaggaggaagatgaaatcaaagacagtggggggatggaggcagataacaga
gcttcatga

DBGET integrated database retrieval system