KEGG   Mus musculus (mouse): 382053Help
Entry
382053            CDS       T01002                                 

Gene name
Ces3a, Ces3, Ces31, Es31
Definition
carboxylesterase 3A (EC:3.1.1.1)
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     382053 (Ces3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 D3; 8
AA seq 524 aa AA seqDB search
MTNMETTAQAGSSVRVWMACLLLIFPTTVIGPKVTQPEVDTPLGRVRGRQVGVKDTDRMV
NVFLGIPFAQAPLGPLRFSAPLPPQPWEGVRDASINPPMCLQDVERMSNSRFTLNEKMKI
FPISEDCLTLNIYSPTEITAGDKRPVMVWIHGGSLLVGSSTSHDGSALAAYGDVVVVTVQ
YRLGIFGFLSTGDKHMPGNRGFLDVVAALRWVQGNIAPFGGDPNCVTIFGNSAGGIIVSS
LLLSPMSAGLFHRAISQSGVVISKILEDLNAWSEAQNFANSVACGSASPAELVQCLLQKE
GKDLITKFWNILDKMEHLSQEDLLENSRPLLAHMQLPPEIMPTVIDEYLDNGSDESATRY
ALQELLGDITLVIPTLIFSKYLQDAGCPVFLYEFQHTPSSFAKFKPAWVKADHSSENAFV
FGGPFLTDESSLLAFPEATEEEKQLSLTMMAQWSQFARTGNPNGKGLPPWPQLNQLEQYL
EIGLEPRTGVKLKKGRLQFWTETLPRKIQEWHREQRSRKVPEEL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatatggagacaacggcacaagctgggtccagtgtccgagtctggatggcctgt
ctgctcctgatatttcctaccactgtcattggacccaaagtcactcagcctgaagtggat
acccccctgggtcgtgttcgaggccggcaggtgggtgtgaaggacacagaccgcatggta
aatgtcttcctgggcatcccctttgctcaagcaccactgggacctcttcggttctcagct
ccactcccaccacagccctgggaaggtgtgagagatgccagcatcaatcccccaatgtgc
cttcaggatgtagagagaatgagcaacagcagattcaccctcaatgaaaagatgaaaatc
ttccccatttctgaggactgcctgaccctcaacatctacagccccactgagatcactgca
ggggacaaaaggccggtcatggtatggatccacggaggctctctgctggttggctcctcc
acatctcatgatggatcagcactggctgcctatggggatgtggtagttgtcactgtccag
tatcgccttgggatctttggcttcctcagcactggagacaagcacatgccaggcaacagg
ggattcctggatgtggtggctgctcttcgctgggtccaggggaacatagccccctttggg
ggtgatcccaactgtgtcactatcttcggtaactctgctggaggcattattgtctcatcc
ctgctcctgtctccaatgtctgctgggctcttccacagagccatatcgcagagtggggtt
gtcatcagcaagattctggaagacttgaatgcatggtctgaagctcagaactttgccaat
tctgtggcctgtggctctgcatccccagctgagctggtccagtgtttgctgcagaaggaa
ggaaaggaccttatcacgaagttctggaatatcctggataagatggaacatttgagccag
gaagacctgttggagaattcaaggcccttattagcccatatgcaactgccccctgagatc
atgcccaccgtcatagatgaatacctagacaatggctcagatgaatcagctacaaggtat
gccctccaggaattgctgggtgatatcacattggtcattcctaccttgatcttctcaaaa
taccttcaagatgctgggtgccctgttttcttgtacgagttccagcatacacccagttct
tttgcaaagttcaagccagcctgggtgaaggctgaccattcctctgagaatgcctttgtt
tttggaggtcctttcctcactgatgagagttccctcctggccttcccagaggccacagag
gaagagaagcagctgagcctgaccatgatggcccaatggagccagtttgcacgcacagga
aatcccaatggcaaggggctgcctccttggccccaattaaaccagttagaacaatacttg
gagattggtctagaaccacggactggggtgaagctaaagaagggtcggctacagttctgg
acagagacactgccaagaaaaattcaagaatggcaccgagagcagagaagcaggaaagtt
ccagaggagctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system