KEGG   Mus musculus (mouse): 435529Help
Entry
435529            CDS       T01002                                 

Gene name
Adgrf2, Gpr111, PGR20
Definition
(RefSeq) adhesion G protein-coupled receptor F2
  KO
K08454  
G protein-coupled receptor 111
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class B. Secretin receptor family
  Other
   Putative / unclassified Class B GPCRs
    435529 (Adgrf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17; 17 B3
AA seq 644 aa AA seqDB search
MIPAHWLYCLMLLLPIESCRILCQASSKSKEKVTSRPHDVCDGVCNNNGTPCFQSCPPDS
EGNMKFACKAKKWHKVTETCHTLNTHSIFEEDKELYSVQSSDSTIRTHMFHRELKTIMDT
LMEKCPKDLSCVIKGIERSPRMPGNIAVVVQLLHNISTTLTKDVNEEKMQSYSAMANHIL
NSKSISNWTFIQDRNSSCVLLQSIHSFASKLFMKEHLINISHVFIHTLGTVVSRGSLGKN
FTFSMRINETSDKVTGRLLLSPEELQKVPSAFQVISIAFPTLGAILEASLLENVTVNGLV
LSVILPEELKNISLIFEKIRKSGERKSQCVGWHSLESRWDWRACKTIQENSRQAVCRCRP
NKLYTSFSILMSPNTLESPVLTYITYIGLGISICSLIICLAIEVLVWSQVTKTEISYLRH
LCIANIAATLLMADAWFIVASFLSGPVLHHNGCVAATFFVHFFYLSVFFWMLAKALLILY
GILIVFHTLPKSCLVASLFSVGYGCPLVIAIITLAVTEPGKGYLRPEACWLNWDMTKALL
AFVVPALAIVVVNLITVTMVIIKTQRAAIGSSMFQEVRAIVRICKNIAILTPLLGLTWGF
GIATVINGHSLAFHIIFSLLNALQVSPDAAVDSELRECVHRFCG
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgattcctgcccattggttgtactgtttgatgcttcttttgcctatagaatcctgtagg
atattatgccaggcctccagcaaaagcaaggagaaggtgacatccagaccacatgatgtc
tgtgatggtgtctgtaataacaatggcaccccctgctttcagtcttgtcctccagacagt
gagggcaacatgaaatttgcctgtaaggccaagaaatggcacaaagtcactgaaacctgc
cacactctcaatacccacagcatctttgaggaggataaggaactatattcagttcaatca
tctgattcaaccatacgtacacacatgtttcatagagaacttaaaaccataatggatacg
ttgatggaaaagtgtccaaaggatttgtcttgtgtgatcaaaggcattgagagatctcct
cggatgccagggaacattgctgtggtggtgcagctcttacacaacatctcaacaactcta
accaaagacgtcaatgaggaaaagatgcagagttacagtgccatggctaaccacattctt
aacagtaaaagcatatcaaattggaccttcatccaagacagaaacagcagctgtgtcttg
cttcaatcaatccattcatttgcaagcaagctatttatgaaggaacatctcatcaacata
tcacatgtctttattcataccttggggacggtcgtgtccaggggcagccttgggaagaat
ttcacgttctcaatgcgaattaatgagacaagtgataaggtcactgggaggctactgctc
agccctgaagagcttcagaaggtgccttctgctttccaggtcatcagcattgctttccca
actcttggggccatcctggaggccagtcttttggaaaatgtgactgtgaatgggctcgtc
ctgtctgtcattttgcccgaggagcttaaaaacatctcactgatatttgaaaagatcaga
aaatctggagagaggaagtcccagtgtgtgggatggcactccttggagagcagatgggac
tggagggcttgtaaaacgattcaagaaaactccaggcaagctgtttgccgttgtcggccg
aataagttatatacttctttctccattctaatgtctcccaacacgttggaaagccctgtt
ctaacttatattacatacataggcctgggcatttccatctgcagcttgatcatctgcctg
gccattgaggtcttagtctggagtcaagtgacaaagacagagatctcatatttacgtcac
ctgtgcatcgctaacattgcggccaccttgctgatggctgatgcgtggttcatcgtggcg
tctttcctcagtggcccagtactacaccacaatggatgtgtggccgccacgttttttgtt
cacttcttttacctgtccgtgtttttctggatgcttgccaaggctctccttatcctctat
ggaattctcattgtgtttcatacactgcccaagtcgtgcctggtggcctctctgttttcc
gtgggctatgggtgccctttggtcatcgccattatcacacttgccgttacagagcctgga
aaaggctacctccggcccgaggcctgctggcttaattgggacatgaccaaggctctcctg
gcctttgtagtaccagctctggccattgttgtagtaaacctgattacagtcacaatggtc
atcatcaagacccagagagctgccatcggtagttccatgttccaggaagtaagagccatc
gtgaggatctgtaagaacattgccatcctcacaccactgctggggctgacctggggattt
gggatagccacagtcattaatggtcactccctggccttccacattatcttctccttactc
aatgcactccaggtaagtccggatgctgcagtagactctgaattgagagagtgtgtgcat
cggttttgtgggtag

DBGET integrated database retrieval system