KEGG   Mus musculus (mouse): 54631Help
Entry
54631             CDS       T01002                                 

Gene name
Nphs1, NephrinB, nephrin
Definition
(RefSeq) nephrosis 1, nephrin
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 A3
AA seq 1256 aa AA seqDB search
MGAKEATVRGPGASPVHRTCHLIPLLLAGMLTTGLAQSPVPTSAPRGFWALSENLTVVEG
STVKLWCGVRAPGSVVQWAKDGLLLGPNPKIPGFPRYSLEGDSAKGEFHLLIEACDLSDD
AEYECQVGRSELGPELVSPSVILSILVSPKVLQLTPEAGSTVTWVAGQEYVVTCVSGDAK
PAPDIIFIQGGRTVEDVSSSVNEGSEEKLFFTEAEARVTPQSSDNGQLLVCEGSNPALAT
PIKASFTMNILFPPGPPVIDWPGLNEGHVRAGENLELPCIARGGNPPATLQWLKNGKPVS
IAWGTEHAQAVAHSVLVMTVRPEDHGARLSCQSYNSVSAETQERSITLQVTFPPSAVTIL
GSTSQSENKNVTLCCLTKSSRPRVLLRWWLGGRQLLPTDETVMDGLHGGHISMSNLTLLV
KREDNGLSLTCEAFSDAFSKETFKKSLTLNVKYPAQKLWIEGPPEGQSIRTGTRVRLVCL
AIGGNPEPSLTWLKDSRPVNDPRQSQEPRRVQLGSVEKSGSTFSRELVLIIGPPDNLAKF
SCKAGQLSASTQLVVQFPPTNLTILANSSALRPGDALNLTCVSISSNPPVNLSLDKEGER
LDDVAAKPQSAPFKGSAASRSVFLRVSSRDHGHRVTCRAHSEALRETVSSFYRLNVLYPP
EFLGEQVRAVTVVEQGQALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSGGALQL
WNVTRADDGFYQLHCQNSEGTAEALLKLDVHYAPTIRALKDPTEVNVGGSVDIVCTVDAN
PILPEMFSWERLGEDEEELNLDDMEKMSKGSTGRLRIRQAKLSQAGAYQCIVDNGVAPAA
RGLVRLVVRFAPQVDHPTPLTKVAAAGDSTSSATLHCRARGVPNIDFTWTKNGVPLDLQD
PRYTEHKYHQGVVHSSLLTIANVSAAQDYALFKCTATNALGSDHTNIQLVSISRPDPPLG
LKVVSVSPHSVGLEWKPGFDGGLPQRFQIRYEALESPGFLYMDVLPAQATTFTLTGLKPS
TRYRIWLLASNALGDSGLTDKGIQVSITTPGLDQAPEDTDQPLPTEQPPGPPRLPLLPVL
FAVGGLLLLSNASCVGGLLWRRRLRRLAEEISEKTEAGSEEDRIRNEYEESQWTGDRDTR
SSTVSTAEVDPHYYSMRDFSPQLPPTLEEVSYRQAFTGIEDEDMAFPGHLYDEVERVYGP
PGVWGPLYDEVQMDPYDLRWPEVKYEDPRGIYDQVAADMDAGEPGSLPFELRGHLV
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atgggagctaaggaagccacagtcagaggccccggggcaagcccagtgcacagaacttgc
cacctgattcccctgctgctcgcgggaatgctgaccacaggcctggcccagtcgccagtc
cccacctcagcacctcgaggcttctgggctctatctgaaaacctgactgtggtggaaggg
tcgacagttaagctgtggtgtggcgtcagggcccccggcagtgtggtgcagtgggctaag
gatgggctgcttctgggtccaaaccctaagattccaggcttcccaaggtacagcctggaa
ggagacagtgctaaaggtgagttccacctgcttattgaagcctgtgacctcagcgatgat
gcggagtacgagtgccaagtcggccgctccgagttgggtcccgagctcgtgtctcccagc
gtaatcctctccatcctagtttcccccaaggtgcttcagttaacccctgaggcaggaagc
acagttacctgggtagctggacaggaatatgtggtcacctgtgtgtctggggatgcaaag
ccagcacctgacatcatcttcatccagggtggacgcacggtagaggatgtctcctccagc
gtgaatgagggatcagaggagaaactcttcttcacggaagccgaagccagggtgacaccc
cagagctcagataatgggcagctgctagtctgcgaggggtccaacccagccttggccact
cccataaaggcttcgttcaccatgaatatcctgttccccccaggacctcctgtcattgat
tggccaggcctgaatgaggggcatgtacgggcaggggagaacctggagctaccctgcata
gccagaggtggaaatccacctgcgaccctgcagtggctgaagaatggtaaaccagtgtcc
atagcttggggcacagagcatgcccaggcagtggctcacagtgtgctggtgatgaccgtt
cgacctgaagaccacggagctcggctcagctgtcagtcctacaacagtgtgtctgcagag
acccaggagcgaagcatcactctgcaggtcacctttccccccagtgccgttaccatcctg
ggatctacatcacagtctgagaacaaaaatgtgaccctttgctgccttaccaagtccagt
cgcccacgggtcctgctgcgatggtggttgggtggacggcagttgctgcccacggatgag
acagtcatggatggcctgcatggtggccacatctccatgtccaatctgacactcttggtg
aagagagaagacaatggcctgtccctcacctgcgaagccttcagtgatgccttcagcaag
gagaccttcaagaagtcactcaccttgaatgtaaaatacccggcccagaagctgtggatt
gagggacccccagaggggcagagcatccggactggaactcgggtgaggctggtatgcttg
gccattggaggcaacccagagccctccctcacctggcttaaggattcgcgcccggtgaac
gatcctcggcagtctcaggagccccggcgtgtgcagctgggcagtgtggagaagtccggc
agcactttctcccgcgagctggtgctgatcataggcccgccggacaacctagccaagttc
tcctgcaaggcgggtcagctcagtgcgtctacgcagctggtggtgcagttccccccaaca
aacctgaccatcctggccaactcgtccgcactgcgcccaggcgacgccttgaacttgacc
tgcgtcagcatcagcagcaaccctccagttaacttgtctttggacaaggaaggagagagg
ctggacgacgtggctgcaaaaccccagagcgccccattcaaaggctccgctgcatccagg
agtgtttttcttcgggtgtcatcccgagaccacggtcaccgggttacctgccgggcccac
agcgaggcacttcgtgaaaccgtgagctctttctaccgcctcaacgtgttataccctcca
gagttcctgggagagcaagtgcgggcagtgaccgtggtggagcagggccaggcactgctg
cctgtgtccgtgtctgctaaccccgcccccgaggccttcaactggaccttccgaggctac
cgcctcagcccagctgggggtccccggcaccgcatcctgtctggaggggcactgcagctg
tggaatgtaacccgagctgacgatggcttttatcagctacactgccagaactcggagggc
accgccgaggcgctgttgaagctggacgtgcattatgctcccaccatccgtgccctgaag
gaccctactgaggtgaatgttgggggttctgtggatatagtctgcaccgtcgatgccaat
cccatcctcccagagatgttcagctgggagagactgggggaagacgaggaggaactgaac
ctggacgacatggagaagatgtcaaagggatccacagggcgtctgcggattcgccaggcc
aagctgtcccaggctggcgcttaccagtgcatcgtggacaacggggtggctcccgcagcc
agaggactggttcgtcttgttgtccgatttgccccccaggtggatcatcctactcccctg
acgaaagtggctgctgctggggacagcaccagctcagccacactccactgccgtgcccgg
ggggtccccaacatcgacttcacttggaccaaaaatggggtccctctggatctccaagac
cccaggtacacagagcacaagtaccaccagggtgtggtccacagcagcctcctgaccatt
gctaatgtgtctgcagcccaggactatgccctcttcaaatgcacagccaccaatgccctt
ggttcagaccacaccaacatccagctcgtcagcatcagccgtcctgaccctccactgggg
ctgaaggttgtgagcgtgagccctcactcggtaggactggagtggaaacctggctttgat
gggggtctgcctcagaggttccaaatcaggtatgaggccctcgagagcccaggattcctc
tacatggatgtcctgcctgcacaggccaccaccttcacactgactgggctgaagccttct
acacggtacaggatctggctgttggccagcaatgccctgggggacagtggattgacggac
aaggggatccaggtctccatcactaccccaggcctggaccaggctcctgaagacacagac
cagccgctgcccacagagcagcctccgggacccccgaggctgcccctgctgcctgtgctc
tttgcggttggtggtcttctgttgctttccaatgcctcctgtgttgggggactcctctgg
cggagaagactgaggcgccttgctgaggagatctcagagaagacagaggcagggtcggag
gaggatcgaatcaggaatgaatatgaggagagtcagtggactggggaccgggacacaaga
agctccacggttagcacagcagaagtggacccacactactactccatgagggacttcagt
ccccagcttcccccaacactggaagaggtgtcatatcgccaagccttcacaggtattgaa
gatgaggacatggccttccccggacacctgtatgacgaggtggagagagtctatggccca
cctggggtctggggacccctctatgatgaagtacaaatggacccctatgaccttcgctgg
cctgaggtcaaatatgaggacccaaggggaatctacgaccaggtggcggcagacatggat
gctggggagcctggttctctgccctttgagctgaggggacatctggtgtga

DBGET integrated database retrieval system