KEGG   Mus musculus (mouse): 55984Help
Entry
55984             CDS       T01002                                 

Gene name
Camkk1, AI846603, CaMKKalpha, Camkk
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 1, alpha
  KO
K00908  
calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    55984 (Camkk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     55984 (Camkk1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  CAMKK family
   55984 (Camkk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 B4
AA seq 505 aa AA seqDB search
MESGPAVCCQDPRAELVDRVAAINVAHLEEADEGPEPARNGVDPPPRARAASVIPGSASR
PTPVRPSLSARKFSLQERPAGSCLGAQVGPYSTGPASHISPRSWRRPTIESHRVAISDTE
DCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
ATQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVME
VPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQF
EGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDYILT
LHRKIKNEAVVFPEEPEVSEDLKDLILRMLDKNPETRIGVSDIKLHPWVTKHGEEPLPSE
EEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGSL
LMKEGCGEGCKSPELPGVQEDEAAS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggagagtggcccagccgtctgctgccaagaccctcgtgcagagctggtggatcgggtg
gcggccatcaatgtggcccacttggaagaagcagatgagggtccagagcctgccaggaat
ggtgtggatcctccaccccgggccagagctgcctccgtgatccctggcagtgcttcaaga
cccactccagtgcgccccagcctctcggctagaaagttctccctgcaggaacgaccagct
ggaagctgtctgggggctcaagttgggccttactctacaggacctgccagtcacatctct
cctcggtcctggcggagacccaccatcgagtcccaccgtgtggccatctcagacacagag
gactgtgtgcaactgaaccagtacaagctgcagagtgagattggcaagggtgcctatggt
gtggtgaggctggcctacaacgaaagtgaagacagacactatgcaatgaaagttctttcc
aaaaagaagttactgaagcagtatggctttcctcgccgtcctccccccagagggtcccaa
gctacccagggagggccagccaaacagctgctgcccctggagcgtgtgtatcaggagatt
gccattctaaagaagctggaccacgtgaatgtagtcaaattgatcgaggtcctggatgat
cccgctgaagacaacctctatttggtgttcgacctcctgagaaaagggccagtcatggaa
gtgccctgcgacaagcccttcccagaggagcaagctcgcctctacctccgggacatcatc
ctgggcctcgagtacttgcactgccagaagattgtccacagggacatcaagccatctaac
ctactccttggggacgacgggcatgtgaagatcgccgactttggtgtcagtaaccagttt
gaggggaatgatgctcagctgtccagtacggcagggaccccggcattcatggccccggag
gccatttctgattccggccagagcttcagtgggaaggccttggatgtatgggccactggg
gtcacgctatattgctttgtctatgggaagtgcccgttcattgatgactacatcctgacc
ctgcaccgtaagatcaagaatgaggccgtggtgttccctgaggagccagaggtcagcgag
gacctcaaagacctgatcctgaggatgctagacaagaatcctgagacaagaattggggtg
tcagatatcaagttacacccttgggtgaccaagcatggagaggagcccctcccttcagag
gaggagcactgcagtgtggtggaggtgaccgaggaagaggtgaagaactcagtcaggctc
atccccagctggaccactgtgatcctggtcaagtctatgctgagaaagcgttcctttgga
aacccattcgagccccaagcacgcagggaagaaagatccatgtctgcaccaggaagctta
ctgatgaaagaaggatgcggagaagggtgcaaaagcccagagcttcccggagtccaggag
gatgaggctgcgtcctga

DBGET integrated database retrieval system