KEGG   Mus musculus (mouse): 55984Help
Entry
55984             CDS       T01002                                 

Gene name
Camkk1, AI846603, CaMKKalpha, Camkk
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 1, alpha (EC:2.7.11.17)
  KO
K07359  
calcium/calmodulin-dependent protein kinase kinase [EC:2.7.11.17]
Organism
mmu  Mus musculus (mouse)
Pathway
AMPK signaling pathway
Longevity regulating pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    55984 (Camkk1)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    55984 (Camkk1)
   04921 Oxytocin signaling pathway
    55984 (Camkk1)
  Aging
   04211 Longevity regulating pathway - mammal
    55984 (Camkk1)
 Human Diseases
  Substance dependence
   05034 Alcoholism
    55984 (Camkk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     55984 (Camkk1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  CAMKK family
   55984 (Camkk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 B4
AA seq 505 aa AA seqDB search
MESGPAVCCQDPRAELVDRVAAINVAHLEEADEGPEPARNGVDPPPRARAASVIPGSASR
PTPVRPSLSARKFSLQERPAGSCLGAQVGPYSTGPASHISPRSWRRPTIESHRVAISDTE
DCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
ATQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVME
VPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQF
EGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDYILT
LHRKIKNEAVVFPEEPEVSEDLKDLILRMLDKNPETRIGVSDIKLHPWVTKHGEEPLPSE
EEHCSVVEVTEEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGSL
LMKEGCGEGCKSPELPGVQEDEAAS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggagagtggcccagccgtctgctgccaagaccctcgtgcagagctggtggatcgggtg
gcggccatcaatgtggcccacttggaagaagcagatgagggtccagagcctgccaggaat
ggtgtggatcctccaccccgggccagagctgcctccgtgatccctggcagtgcttcaaga
cccactccagtgcgccccagcctctcggctagaaagttctccctgcaggaacgaccagct
ggaagctgtctgggggctcaagttgggccttactctacaggacctgccagtcacatctct
cctcggtcctggcggagacccaccatcgagtcccaccgtgtggccatctcagacacagag
gactgtgtgcaactgaaccagtacaagctgcagagtgagattggcaagggtgcctatggt
gtggtgaggctggcctacaacgaaagtgaagacagacactatgcaatgaaagttctttcc
aaaaagaagttactgaagcagtatggctttcctcgccgtcctccccccagagggtcccaa
gctacccagggagggccagccaaacagctgctgcccctggagcgtgtgtatcaggagatt
gccattctaaagaagctggaccacgtgaatgtagtcaaattgatcgaggtcctggatgat
cccgctgaagacaacctctatttggtgttcgacctcctgagaaaagggccagtcatggaa
gtgccctgcgacaagcccttcccagaggagcaagctcgcctctacctccgggacatcatc
ctgggcctcgagtacttgcactgccagaagattgtccacagggacatcaagccatctaac
ctactccttggggacgacgggcatgtgaagatcgccgactttggtgtcagtaaccagttt
gaggggaatgatgctcagctgtccagtacggcagggaccccggcattcatggccccggag
gccatttctgattccggccagagcttcagtgggaaggccttggatgtatgggccactggg
gtcacgctatattgctttgtctatgggaagtgcccgttcattgatgactacatcctgacc
ctgcaccgtaagatcaagaatgaggccgtggtgttccctgaggagccagaggtcagcgag
gacctcaaagacctgatcctgaggatgctagacaagaatcctgagacaagaattggggtg
tcagatatcaagttacacccttgggtgaccaagcatggagaggagcccctcccttcagag
gaggagcactgcagtgtggtggaggtgaccgaggaagaggtgaagaactcagtcaggctc
atccccagctggaccactgtgatcctggtcaagtctatgctgagaaagcgttcctttgga
aacccattcgagccccaagcacgcagggaagaaagatccatgtctgcaccaggaagctta
ctgatgaaagaaggatgcggagaagggtgcaaaagcccagagcttcccggagtccaggag
gatgaggctgcgtcctga

DBGET integrated database retrieval system