KEGG   Mus musculus (mouse): 56421Help
Entry
56421             CDS       T01002                                 

Gene name
Pfkp, 1200015H23Rik, 9330125N24Rik, PFK-C
Definition
phosphofructokinase, platelet (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
AMPK signaling pathway
Thyroid hormone signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    56421 (Pfkp)
   01230 Biosynthesis of amino acids
    56421 (Pfkp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    56421 (Pfkp)
   00030 Pentose phosphate pathway
    56421 (Pfkp)
   00051 Fructose and mannose metabolism
    56421 (Pfkp)
   00052 Galactose metabolism
    56421 (Pfkp)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    56421 (Pfkp)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    56421 (Pfkp)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     56421 (Pfkp)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     56421 (Pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 A1; 13
AA seq 784 aa AA seqDB search
MSDLDSSSSSAYPKYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYFIY
EGYQGLVDGGSNIVEAKWDCVSSILQVGGTIIGSARCKAFRSREGRLKAACNLARLGITN
LCVIGGDGSLTGANLFRKEWSGLLEELARNGDIDNDTVQKYSYLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALTCGADWVFLPE
SPPEEDWEENMCLKLSENRARKKRLNIIIVSEGAIDMQNKPITSEKIKELVVKNLGFDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPETPACVVSLRGNQAVRLPLMECV
QMTQDVQKAMDERRFKEAVKLRGRRFEGNLNTYKRLAIKLPDEKIVKSNCNVAVINVGAP
AAGMNAAVRSAVRVGIADGHKMFAIYDGFEGFANGQIKEIGWADVGGWTGQGGSILGTKR
TLPGKYLEKIAEQMHSHSINALLIIGGFEGYHGAIMLSEARNNHEEFCIPICVLPATISN
DIPGSDISIGCDTALNVIVETCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGAD
AAYIFEEPFDIGDLQSNVVHLTEKMKTSIQRGLVLRNESCSVNYTTDFIYQLYSEEGKGV
FDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMEWISAKLKGSQGTGKKFVSDDSICVLG
ICKRDLLFQPVAELKKVTDFEHRIPKEQWWLKLRPIMKILAKYEASYDMSDSGKLESLQH
HEEL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacttggattcttcgagctccagcgcctatccgaagtacctggagcacctctct
ggggatggcaaagctatcggtgtcctgaccagcggcggggatgcccaaggcatgaatgct
gctgtccgcgctgtggtgcgcatgggaatctacacgggggccaaagtgtactttatatat
gagggttaccaaggcttggtggatggaggctccaatattgtggaagccaaatgggactgt
gtctccagcattctgcaagtgggtgggaccatcatcggtagtgcgcgctgcaaagccttt
cgaagccgtgaagggcgcctgaaagctgcctgtaacttggcgcgcttgggcataaccaat
ctgtgcgtgatcggcggggacggaagtctcacgggagccaacctcttccgaaaggagtgg
agcggacttctggaagagctggctcggaatggtgatatcgataacgacacagtgcagaag
tattcctacctcaacgtggtgggtatggtgggctccattgacaatgacttctgtggcaca
gacatgaccattggtacagattcagccctgcaccgaattattgaagttgttgatgccatc
atgaccactgctcagagccaccagaggaccttcgtcctggaggtgatggggagacactgt
ggttacttggccttggtgagcgccttgacttgcggtgccgactgggtgttccttccggag
tctccacctgaggaagattgggaggaaaatatgtgcctcaaactctcagagaaccgagcc
cgaaaaaagaggctgaatatcatcattgtgtctgaaggagcaatcgacatgcaaaataag
ccaatcacctctgagaaaatcaaggagcttgtagtgaagaatttgggatttgacacccgg
gtcaccatccttgggcatgtccaacgaggagggaccccatctgcatttgacaggattttg
gccagccgtatgggagtggaggctgtcattgccttgctggaagctacccccgagacccca
gcctgtgtcgtgtcactaagaggaaaccaagcagtgcgcctgccactgatggagtgtgtg
caaatgacccaggatgtacagaaggcaatggatgaaagaagatttaaggaagccgtgaaa
ctccgaggaaggcgttttgagggaaacctgaacacctataagcgtcttgccattaaactg
cctgatgagaagattgtcaagagcaactgcaatgtagccgtcatcaatgtaggggcacct
gctgccggaatgaatgcagccgtgcgctctgctgttcgagtcgggattgcagacggccac
aagatgtttgcaatctatgacggctttgaaggattcgccaatggccaaatcaaagaaatc
ggctgggcagatgtcggaggctggactggacaaggagggtccattcttgggacaaaacgc
accctacctggaaagtacttggagaagatcgcagagcagatgcattcccatagtatcaat
gcccttctgatcattggaggatttgagggttatcatggtgccatcatgctatctgaggct
cgaaacaaccatgaggagttttgtatcccaatatgtgttttgcctgccactattagcaac
gatatccctggctcagacatcagtatcggttgtgatactgccctgaatgtgattgtcgag
acgtgcgaccgcattaaacagtcagccagtgggaccaagcgccgggtgttcatcattgag
accatgggtggatactgtggctacctggccaacatgggggcccttgcagcaggagctgat
gctgcctacatctttgaagagccatttgatatcggagatttgcagtccaacgtcgtgcac
ttgacagagaaaatgaagaccagcatccagaggggcctcgtactcagaaacgaaagctgc
agtgtaaattataccactgacttcatctaccagctctactcagaggagggcaaaggagtg
tttgactgcaggaaaaacgtgctgggccatatgcagcaggggggagcaccgtctccattc
gataggaactttggaaccaagatttctgccaaagcaatggagtggatctcggccaaactg
aaggggtcccagggcacagggaaaaaatttgttagcgatgattccatttgtgtcctggga
atttgcaagagagatctcctgtttcaaccagtggcagagctgaagaaagtcactgacttt
gagcacaggatccccaaggagcagtggtggctgaaactgcggcccatcatgaagatcttg
gccaagtatgaggcgagctatgacatgtctgattcaggcaagctggagtccttgcagcac
catgaagaactatga

DBGET integrated database retrieval system