KEGG   Mus musculus (mouse): 56421Help
Entry
56421             CDS       T01002                                 

Gene name
Pfkp, 1200015H23Rik, 9330125N24Rik, PFK-C
Definition
phosphofructokinase, platelet (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Thyroid hormone signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mmu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmu01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmu00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mmu00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mmu00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mmu00052]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mmu04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 A1; 13
AA seq 784 aa AA seqDB search
MSDLDSSSSSAYPKYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYFIY
EGYQGLVDGGSNIVEAKWDCVSSILQVGGTIIGSARCKAFRSREGRLKAACNLARLGITN
LCVIGGDGSLTGANLFRKEWSGLLEELARNGDIDNDTVQKYSYLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALTCGADWVFLPE
SPPEEDWEENMCLKLSENRARKKRLNIIIVSEGAIDMQNKPITSEKIKELVVKNLGFDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPETPACVVSLRGNQAVRLPLMECV
QMTQDVQKAMDERRFKEAVKLRGRRFEGNLNTYKRLAIKLPDEKIVKSNCNVAVINVGAP
AAGMNAAVRSAVRVGIADGHKMFAIYDGFEGFANGQIKEIGWADVGGWTGQGGSILGTKR
TLPGKYLEKIAEQMHSHSINALLIIGGFEAYLGLLELAAAREKHEAFCVPMVMVPATVSN
NVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGAD
AAYIFEEPFDIGDLQSNVVHLTEKMKTSIQRGLVLRNESCSVNYTTDFIYQLYSEEGKGV
FDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMEWISAKLKGSQGTGKKFVSDDSICVLG
ICKRDLLFQPVAELKKVTDFEHRIPKEQWWLKLRPIMKILAKYEASYDMSDSGKLESLQH
HEEL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacttggattcttcgagctccagcgcctatccgaagtacctggagcacctctct
ggggatggcaaagctatcggtgtcctgaccagcggcggggatgcccaaggcatgaatgct
gctgtccgcgctgtggtgcgcatgggaatctacacgggggccaaagtgtactttatatat
gagggttaccaaggcttggtggatggaggctccaatattgtggaagccaaatgggactgt
gtctccagcattctgcaagtgggtgggaccatcatcggtagtgcgcgctgcaaagccttt
cgaagccgtgaagggcgcctgaaagctgcctgtaacttggcgcgcttgggcataaccaat
ctgtgcgtgatcggcggggacggaagtctcacgggagccaacctcttccgaaaggagtgg
agcggacttctggaagagctggctcggaatggtgatatcgataacgacacagtgcagaag
tattcctacctcaacgtggtgggtatggtgggctccattgacaatgacttctgtggcaca
gacatgaccattggtacagattcagccctgcaccgaattattgaagttgttgatgccatc
atgaccactgctcagagccaccagaggaccttcgtcctggaggtgatggggagacactgt
ggttacttggccttggtgagcgccttgacttgcggtgccgactgggtgttccttccggag
tctccacctgaggaagattgggaggaaaatatgtgcctcaaactctcagagaaccgagcc
cgaaaaaagaggctgaatatcatcattgtgtctgaaggagcaatcgacatgcaaaataag
ccaatcacctctgagaaaatcaaggagcttgtagtgaagaatttgggatttgacacccgg
gtcaccatccttgggcatgtccaacgaggagggaccccatctgcatttgacaggattttg
gccagccgtatgggagtggaggctgtcattgccttgctggaagctacccccgagacccca
gcctgtgtcgtgtcactaagaggaaaccaagcagtgcgcctgccactgatggagtgtgtg
caaatgacccaggatgtacagaaggcaatggatgaaagaagatttaaggaagccgtgaaa
ctccgaggaaggcgttttgagggaaacctgaacacctataagcgtcttgccattaaactg
cctgatgagaagattgtcaagagcaactgcaatgtagccgtcatcaatgtaggggcacct
gctgccggaatgaatgcagccgtgcgctctgctgttcgagtcgggattgcagacggccac
aagatgtttgcaatctatgacggctttgaaggattcgccaatggccaaatcaaagaaatc
ggctgggcagatgtcggaggctggactggacaaggagggtccattcttgggacaaaacgc
accctacctggaaagtacttggagaagatcgcagagcagatgcattcccatagtatcaat
gcccttctgatcattggaggatttgaggcctacctaggactcctagagctggcagctgcc
cgggagaaacatgaggcgttctgtgtccccatggttatggttcctgctactgtctccaac
aatgtgccgggttccgatttcagcatcggggcagacacagctctgaacactatcacagac
acgtgcgaccgcattaaacagtcagccagtgggaccaagcgccgggtgttcatcattgag
accatgggtggatactgtggctacctggccaacatgggggcccttgcagcaggagctgat
gctgcctacatctttgaagagccatttgatatcggagatttgcagtccaacgtcgtgcac
ttgacagagaaaatgaagaccagcatccagaggggcctcgtactcagaaacgaaagctgc
agtgtaaattataccactgacttcatctaccagctctactcagaggagggcaaaggagtg
tttgactgcaggaaaaacgtgctgggccatatgcagcaggggggagcaccgtctccattc
gataggaactttggaaccaagatttctgccaaagcaatggagtggatctcggccaaactg
aaggggtcccagggcacagggaaaaaatttgttagcgatgattccatttgtgtcctggga
atttgcaagagagatctcctgtttcaaccagtggcagagctgaagaaagtcactgacttt
gagcacaggatccccaaggagcagtggtggctgaaactgcggcccatcatgaagatcttg
gccaagtatgaggcgagctatgacatgtctgattcaggcaagctggagtccttgcagcac
catgaagaactatga

DBGET integrated database retrieval system