KEGG   Mus musculus (mouse): 56843Help
Entry
56843             CDS       T01002                                 

Gene name
Trpm5, 9430099A16Rik, LTrpC-5, Ltrpc5, Mtr1
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 5
  KO
K04980  
transient receptor potential cation channel subfamily M member 5
Organism
mmu  Mus musculus (mouse)
Pathway
Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    56843 (Trpm5)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   56843 (Trpm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F5
AA seq 1158 aa AA seqDB search
MQTTQSSCPGSPPDTEDGWEPILCRGEINFGGSGKKRGKFVKVPSSVAPSVLFELLLTEW
HLPAPNLVVSLVGEERPLAMKSWLRDVLRKGLVKAAQSTGAWILTSALHVGLARHVGQAV
RDHSLASTSTKIRVVAIGMASLDRILHRQLLDGVHQKEDTPIHYPADEGNIQGPLCPLDS
NLSHFILVESGALGSGNDGLTELQLSLEKHISQQRTGYGGTSCIQIPVLCLLVNGDPNTL
ERISRAVEQAAPWLILAGSGGIADVLAALVSQPHLLVPQVAEKQFREKFPSECFSWEAIV
HWTELLQNIAAHPHLLTVYDFEQEGSEDLDTVILKALVKACKSHSQEAQDYLDELKLAVA
WDRVDIAKSEIFNGDVEWKSCDLEEVMTDALVSNKPDFVRLFVDSGADMAEFLTYGRLQQ
LYHSVSPKSLLFELLQRKHEEGRLTLAGLGAQQARELPIGLPAFSLHEVSRVLKDFLHDA
CRGFYQDGRRMEERGPPKRPAGQKWLPDLSRKSEDPWRDLFLWAVLQNRYEMATYFWAMG
REGVAAALAACKIIKEMSHLEKEAEVARTMREAKYEQLALDLFSECYGNSEDRAFALLVR
RNHSWSRTTCLHLATEADAKAFFAHDGVQAFLTKIWWGDMATGTPILRLLGAFTCPALIY
TNLISFSEDAPQRMDLEDLQEPDSLDMEKSFLCSRGGQLEKLTEAPRAPGDLGPQAAFLL
TRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSGSEVTLYFWVFTLVLE
EIRQGFFTDEDTHLVKKFTLYVEDNWNKCDMVAIFLFIVGVTCRMVPSVFEAGRTVLAID
FMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDGR
LEWIFRRVLYRPYLQIFGQIPLDEIDEARVNCSLHPLLLESSASCPNLYANWLVILLLVT
FLLVTNVLLMNLLIAMFSYTFQVVQGNADMFWKFQRYHLIVEYHGRPALAPPFILLSHLS
LVLKQVFRKEAQHKRQHLERDLPDPLDQKIITWETVQKENFLSTMEKRRRDSEGEVLRKT
AHRVDLIAKYIGGLREQEKRIKCLESQANYCMLLLSSMTDTLAPGGTYSSSQNCGCRSQP
ASARDREYLESGLPPSDT
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaacccagagctcctgccccggcagccccccagatactgaggatggctgggag
cccatcctatgcaggggagagatcaacttcggagggtctgggaagaagcgaggcaagttt
gtgaaggtgccaagcagtgtggccccctccgtgctttttgaactcctgctcaccgagtgg
cacctgccagcccccaacctggtggtgtccctggtgggtgaggaacgacctttggctatg
aagtcgtggcttcgggatgtcctgcgcaaggggctggtgaaagcagctcagagcacaggt
gcctggatcctgaccagtgccctccacgtgggcctggcccgccatgttggacaagctgta
cgtgatcactctctggctagcacatccaccaagatccgtgtagtggccatcggaatggcc
tctctggatcgaatccttcaccgtcaacttctagatggtgtccaccaaaaggaggatact
cccatccactacccagcagatgagggcaacattcagggacccctctgccccctggacagc
aatctctcccacttcatccttgtggagtcaggcgcccttgggagtgggaacgacgggctg
acagagctgcagctgagcctggagaagcacatctctcagcagaggacaggttatgggggc
accagctgcatccagatacctgtcctttgcctgttggtcaatggtgaccccaacacccta
gagaggatttccagggcagtggagcaggctgccccatggctgatcctggcaggttctggt
ggcattgctgatgtactcgctgccctggtgagccagcctcatctcctggtgccccaggtg
gctgagaagcagttcagagagaaattccccagcgagtgtttctcttgggaagccattgta
cactggacagagctgttacagaacattgctgcacacccccacctgctcacagtatatgac
ttcgagcaggagggttcggaggacctggacactgtcatcctcaaggcacttgtgaaagcc
tgcaagagccacagccaagaagcccaagactacctagatgagctcaagttagcagtggcc
tgggatcgcgtggacattgccaagagtgaaatcttcaatggggacgtggaatggaagtcc
tgtgacttggaagaggtgatgacagatgccctcgtgagcaacaagcctgactttgtccgc
ctctttgtggacagcggtgctgacatggccgagttcttgacctatgggcggctgcagcag
ctttaccattctgtgtcccccaagagcctcctctttgaactgctgcagcgtaagcatgag
gagggtaggctgacactggccggcctgggtgcccagcaggctcgggagctgcccattggt
ctgcctgccttctcactccacgaggtctcccgcgtactcaaagacttcctgcatgacgcc
tgccgtggcttctaccaggacgggcgcaggatggaggagagagggccacctaagcggccc
gcaggccagaagtggctgccagacctcagtaggaagagtgaagacccttggagggacctg
ttcctctgggctgtgctgcagaatcgttatgagatggccacatacttctgggccatgggc
cgggagggtgtggctgctgctctggctgcctgcaagatcataaaggaaatgtcccacctg
gagaaagaggcagaggtggcccgcaccatgcgtgaggccaagtatgagcagctggccctg
gatcttttctcagagtgctacggcaacagtgaggaccgtgcctttgccctgctggtgcga
aggaaccacagctggagcaggaccacgtgcctgcacctggccactgaagctgatgccaag
gccttctttgcccatgacggtgtgcaagcattcctgaccaagatctggtggggagacatg
gccacaggcacacccatcctacggcttctgggtgccttcacctgcccagccctcatctac
acaaacctcatctccttcagtgaggatgccccgcagaggatggacctagaagatctgcag
gagccagacagcttggatatggaaaagagcttcctatgcagccggggtggccaattggag
aagctaacagaggcaccaagggctccaggcgatctaggcccacaagctgccttcctgctc
acacggtggaggaagttctggggcgctcctgtgactgtgttcctggggaatgtggtcatg
tacttcgcattcctcttcctgttcacctatgtcctgctggtggacttcaggccaccaccc
caggggccgtctggatccgaggttaccctctatttctgggtgttcacactggtgctggag
gaaatccgacagggcttcttcacagatgaggacacgcacctggtgaagaaattcactctg
tatgtggaagacaactggaacaagtgtgacatggtggccatcttcctgttcattgtggga
gtcacctgtagaatggtgccctcggtgtttgaggctggcaggaccgttctggccattgac
ttcatggtgttcacacttcggctcatccacatctttgctattcacaagcagttgggtcct
aagatcatcattgtagagcgaatgatgaaggatgtcttctttttcctcttcttcctgagc
gtatggcttgtggcctatggtgtgaccactcaggccctgctgcatccccatgatggccgt
ttggagtggattttccgccgtgtgctatacaggccttacctgcagatctttgggcaaatc
cctctggatgaaattgatgaggctcgtgtgaactgttctcttcaccctctgctgctggaa
agctcggcttcctgccctaatctctatgccaactggctggtcattctcctgctggttacc
ttcctgcttgtcactaatgtgctgctcatgaaccttctgatcgccatgttcagctacaca
ttccaggtggtgcaaggcaatgcagacatgttctggaagtttcaacgctaccacctcatc
gttgaataccatggaagaccagctctggccccgcccttcatcctgctcagccacctgagc
ctggtgctcaagcaggtcttcaggaaggaagcccagcataagcgacaacatctggagaga
gacttgcctgaccccttggaccagaagatcattacctgggaaacggttcaaaaggagaac
ttcctgagtaccatggagaaacggaggagggacagcgagggggaggtgctgaggaaaacg
gcacacagagtggacttgattgccaaatacatcggggggctgagagagcaagaaaagagg
atcaagtgtctggaatcacaggccaactactgtatgctcctcttgtcctctatgacggat
acactggctccaggaggcacctactcaagctctcagaactgtggttgcaggagtcagcca
gcctctgctagagacagggagtacctagagtctggcttgccaccctctgacacctga

DBGET integrated database retrieval system