KEGG   Mus musculus (mouse): 59035Help
Entry
59035             CDS       T01002                                 

Gene name
Carm1, Prmt4
Definition
(RefSeq) coactivator-associated arginine methyltransferase 1 (EC:2.1.1.319)
  KO
K05931  
type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
mmu  Mus musculus (mouse)
Pathway
Endocrine resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Drug resistance
   01522 Endocrine resistance
    59035 (Carm1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     59035 (Carm1)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     59035 (Carm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9; 9 A4
AA seq 608 aa AA seqDB search
MAAAAATAVGPGAGSAGVAGPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLE
VRAGPDAAGIALYSHEDVCVFKCSVSRETECSRVGRQSFIITLGCNSVLIQFATPHDFCS
FYNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQN
HTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIP
GKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTD
EQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNF
LEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVR
CLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGT
TPSPPPGSHYTSPSENMWNTGSTYNLSSGVAVAGMPTAYDLSSVIAGGSSVGHNNLIPLA
NTGIVNHTHSRMGSIMSTGIVQGSSGAQGGGGSSSAHYAVNNQFTMGGPAISMASPMSIP
TNTMHYGS
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcggcagcgacggcggtggggccgggtgcggggagcgctggggtggcgggc
ccgggcggcgcggggccctgcgctacagtgtctgtgttcccgggcgcccgcctcctcact
atcggcgacgcgaacggcgagatccagcggcacgcggagcagcaggcgctgcgccttgag
gtgcgcgccggaccagacgcggcgggcatcgccctctacagccatgaagatgtgtgtgtt
ttcaagtgctcggtgtcccgagagacagagtgcagtcgtgtgggcagacagtccttcatc
atcaccctgggctgcaacagcgtcctcatccagtttgccacaccccacgatttctgttct
ttctacaacatcctgaaaacctgtcggggccacacactggagcgctctgtgttcagtgag
cggacagaggaatcctcagctgtgcagtacttccagttctatggctacctatcccagcag
cagaacatgatgcaggactatgtgcggacaggcacctaccagcgtgcgatcctgcagaac
cacacggacttcaaggacaagatcgttctagatgtgggctgtggctctgggatcctgtca
ttttttgctgctcaagcaggagccaggaaaatttatgcagtggaagccagcaccatggct
cagcatgcagaggtcctggtgaagagtaacaatctgacagaccgcatcgtggtcatccct
ggcaaagtagaggaggtctcattgcctgagcaagtggacattatcatctcagagcccatg
ggctacatgctcttcaatgaacgaatgctcgagagctacctccatgccaaaaagtacctg
aagcctagtggaaacatgttccccaccattggtgatgtccacctcgcacccttcactgat
gaacagctctacatggagcagttcaccaaagccaacttctggtaccagccatccttccat
ggagtggacctgtcggccctcagaggcgccgctgtggatgagtacttccggcaacctgtg
gtggacacatttgacatccggatcctgatggccaaatctgtcaagtacacagtgaacttc
ttagaagccaaagaaggcgatttgcacaggatagaaatcccattcaaattccacatgctg
cattcagggctagtccatggcttggccttctggttcgatgttgctttcattggctccata
atgaccgtgtggctatccacagccccaacagagcccctgacccactggtaccaggtccgg
tgcctcttccagtcaccgttgtttgccaaggccggggacacgctctcagggacatgtctg
cttattgccaacaaaagacagagctatgacatcagtattgtggcacaggtggaccagaca
ggctccaagtccagtaacctgctggatctaaagaaccccttcttcaggtacacaggtaca
accccatcacccccacctggctcacactacacgtctccctcggagaatatgtggaacaca
ggaagcacctataatctcagcagcggggtggctgtggctggaatgcctactgcctacgac
ctgagcagtgttattgccggcggctccagtgtgggtcacaacaacctgattcccttagct
aacacagggattgtcaatcacacccactcccggatgggctccataatgagcacgggcatt
gtccaaggctcctcaggtgcccagggaggcggcggtagctccagtgcccactatgcagtc
aacaaccagttcaccatgggtggccctgccatctctatggcctcgcccatgtccatcccg
accaacaccatgcactatgggagttag

DBGET integrated database retrieval system