KEGG   Mus musculus (mouse): 59310Help
Entry
59310             CDS       T01002                                 

Gene name
Myl10, 1700027I08Rik, Mylc2pl, PLRLC, PLRLC-A, PLRLC-B, PLRLC-C
Definition
myosin, light chain 10, regulatory
Orthology
K12756  
myosin regulatory light chain 10
Organism
mmu  Mus musculus (mouse)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mmu04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mmu04510]
Cellular Processes; Cell communication; Tight junction [PATH:mmu04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:mmu04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
5; 5 G1
AA seq 131 aa AA seqDB search
MDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDP
EETILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNL
CYVITHGEEKD
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggaccagaaccgcgatggcttcattgacaaggaggacctgagggacacctttgctgca
ctgggtcgcataaatgtcaagaacgaggaattggaagccatggtgaaggaggctccgggg
cccatcaacttcacagtcttcctgaccatgtttggggagaaactcaagggcacggaccca
gaagagactatactgcacgccttcaaagtgtttgacactgaaggaaaaggctttgtcaag
gctgacttcattaaggaaaagcttatgacgcaggctgaccggttcagtgaggaggaggtc
aagcagatgtttgcagctttcccgccagatgtctgtggcaacttagactacaggaatctg
tgctacgtcatcacacacggcgaggagaaggactag

DBGET integrated database retrieval system