KEGG   Mus musculus (mouse): 66725Help
Entry
66725             CDS       T01002                                 

Gene name
Lrrk2, 4921513O20Rik, 9330188B09Rik, AW561911, D630001M17Rik, Gm927, cI-46
Definition
leucine-rich repeat kinase 2 (EC:2.7.11.1)
Orthology
K08844  
leucine-rich repeat kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    66725 (Lrrk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     66725 (Lrrk2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  LRRK family
   66725 (Lrrk2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   66725 (Lrrk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15; 15 F1
AA seq 2527 aa AA seqDB search
MASGACQGCEEEEEEEALKKLIVRLNNVQEGKQIETLLQLLEDMLVFTYSDRASKLFEDK
NFHVPLLIVLDSYMRVASVQQAGWSLLCKLIEVCPGTLQSLIGPQDIGNDWEVLGIHRLI
LKMLTVHHANVNLSIVGLKALDLLLDSGKLTLLILDEECDIFLLIFDAMHRYSANDEVQK
LGCKALHVLFERVSEEQLTEFVENKDYTILLSTFGSFRRDKEIVYHVLCCLHSLAVTCSN
VEVLMSGNVRCYNLVVEAMKAFPTNENIQEVSCSLFQKLTLGNFFNILVLNEVHVFVVKA
VRQYPENAALQISALSCLALLTETIFLNQDLEERSETQEQSEEEDSEKLFWLEPCYKALV
RHRKDKHVQEAACWALNNLLMYQNSLHEKIGDEDGQFPAHREVMLSMLMHSSSKDVFQAA
AHALSTLLEQNVNFRKILLAKGVYLNVLELMQKHAHAPEVAESGCKMLSHLFEGSNPSLD
TMAAVVPKILTVMKAHGTSLSVQLEALRAILHFVVPGLLEESREDSQCRPNVLRKQCFRT
DIHKLVLVALNRFIGNPGIQKCGLKVISSLAHLPDATETLSLQGAVDSVLHTLQMYPDDQ
EIQCLGLHLMGCLMTKKNFCIGTGHLLAKILASTLQRFKDVAEVQTTGLQTTLSILELSV
SFSKLLVHYSFDVVIFHQMSSSVVEQKDEQFLNLCCKCFAKVAVDDELKNTMLERACDQN
NSIMVECLLLLGADANQVKGATSLIYQVCEKESSPKLVELLLNGGCREQDVRKALTVSIQ
KGDSQVISLLLRKLALDLANNSICLGGFGIGKIDPSWLGPLFPDKSSNLRKQTNTGSVLA
RKVLRYQMRNTLQEGVASGSDGKFSEDALAKFGEWTFIPDSSMDSVFGQSDDLDSEGSES
SFLVKRKSNSISVGEVYRDLALQRCSPNAQRHSNSLGPVFDHEDLLRRKRKILSSDESLR
SSRLPSHMRQSDSSSSLASEREHITSLDLSANELKDIDALSQKCCLSSHLEHLTKLELHQ
NSLTSFPQQLCETLKCLIHLDLHSNKFTSFPSFVLKMPRITNLDASRNDIGPTVVLDPAM
KCPSLKQLNLSYNQLSSIPENLAQVVEKLEQLLLEGNKISGICSPLSLKELKILNLSKNH
IPSLPGDFLEACSKVESFSARMNFLAAMPALPSSITSLKLSQNSFTCIPEAIFSLPHLRS
LDMSHNNIECLPGPAHWKSLNLRELIFSKNQISTLDFSENPHVWSRVEKLHLSHNKLKEI
PPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLNFDFKHVGCKAKDIIR
FLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMKKPELGMQGATVGIDVRDWSIQI
RGKRRKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKA
RASSSPVILVGTHLDVSDEKQRKACISKITKELLNKRGFPTIRDYHFVNATEESDALAKL
RKTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVNEH
QLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVDGCLK
HPKGIISRRDVEKFLSKKKRFPKNYMMQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI
ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPFMLSGRERALRPNRMYWRQGIYL
NWSPEAYCLVGSEVLDNRPESFLKITVPSCRKGCILLGRVVDHIDSLMEEWFPGLLEIDI
CGEGETLLKKWALYSFNDGEEHQKILLDELMKKAEEGDLLINPDQPRLTIPISQIAPDLI
LADLPRNIMLNNDELEFEEAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQE
LVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVAD
GLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRA
PEVARGNVIYNQQADVYSFGLLLHDIWTTGSRIMEGLRFPNEFDELAIQGKLPDPVKEYG
CAPWPMVEKLITKCLKENPQERPTSAQVFDILNSAELICLMRHILIPKNIIVECMVATNL
NSKSATLWLGCGNTEKGQLSLFDLNTERYSYEEVADSRILCLALVHLAAEKESWVVCGTQ
SGALLVINVEEETKRHTLEKMTDSVTCLHCNSLAKQSKQSNFLLVGTADGNLMIFEDKAV
KCKGAAPLKTLHIGDVSTPLMCLSESLNSSERHITWGGCGTKVFSFSNDFTIQKLIETKT
NQLFSYAAFSDSNIIALAVDTALYIAKKNSPVVEVWDKKTEKLCELIDCVHFLKEVMVKL
NKESKHQLSYSGRVKALCLQKNTALWIGTGGGHILLLDLSTRRVIRTIHNFCDSVRAMAT
AQLGSLKNVMLVLGYKRKSTEGIQEQKEIQSCLSIWDLNLPHEVQNLEKHIEVRTELADK
MRKTSVE
NT seq 7584 nt NT seq  +upstreamnt  +downstreamnt
atggccagtggcgcctgtcagggctgcgaagaggaagaggaggaggaggctctgaagaag
ttgatagtcaggctgaataatgtccaggaaggcaagcagatcgagacgttgcttcagctc
ctggaggacatgctggtgttcacctactcggaccgcgcctccaagttatttgaagataaa
aatttccacgtgcctctgttgattgtcctggactcctacatgagagttgccagtgtacag
caggcggggtggtcacttctgtgcaaattaatagaagtctgtccagggacattgcaaagc
ttaataggaccccaggatattggaaatgattgggaagtccttggtattcaccggctgatt
cttaaaatgttaactgttcatcacgccaatgtaaacctgtcaatagttggactaaaagcc
ttggatctcctcctagattcaggtaaactcaccttgctgatactggatgaagaatgtgat
attttcttgttaatttttgatgccatgcacagatattcagccaatgatgaagtccaaaaa
ctgggatgcaaagctttacacgtgctttttgagagagtttccgaggaacagctgactgag
tttgtggagaacaaagattacacgatactgctgagtacgttcggcagcttcagaagggac
aaggagattgtgtaccacgtactttgctgcttgcattccctggcggttacatgcagcaat
gtagaggtcctcatgagtgggaatgtccggtgctacaatcttgtggtggaggccatgaaa
gccttccccaccaatgaaaacatccaagaggtgagctgctccttgttccagaagcttaca
ttaggtaactttttcaacatcctggtgttgaacgaagtgcatgtctttgtggtgaaagcg
gtccgacagtatcctgagaacgcagccttacagatctctgcactcagctgtttagcactc
ctcactgagactattttcttaaaccaagacttggaggaaagaagtgagactcaagagcag
agcgaagaggaagacagtgagaagcttttctggctggaaccctgctataaagccctggtg
cgccatcgaaaggacaaacacgtgcaggaggctgcctgctgggcactaaataacctcctt
atgtaccagaacagtttgcatgagaagatcggagatgaagatggccagttccctgcgcac
agggaagtgatgctgtctatgctgatgcactcttcttccaaagatgtcttccaagcagct
gcacatgctctgtccactctcttggaacaaaatgttaatttcaggaaaatcctgctggca
aaaggagtatacctgaatgtcttggaattgatgcagaagcatgcccatgcgcctgaggtg
gcagagagtggctgcaagatgctgagtcacctgtttgaaggaagtaacccttctctggat
acaatggcagcagtggtccctaaaatactaacagtgatgaaagcccacggaacgtctctg
tcagtccagctggaggcgctgcgagctatcttgcatttcgttgtgccaggactattggaa
gaatccagggaggactctcaatgcagaccaaatgtgctcagaaaacagtgtttcaggact
gacatccacaagctggttctagtcgctctgaacaggttcattgggaatcctgggattcag
aaatgtggattgaaagtaatctcttctctcgcgcaccttcctgatgccacagagacattg
tccctgcaaggagcagttgactcagtcctccacaccttacagatgtatccagatgaccaa
gaaattcagtgtctgggcttacaccttatgggatgcttgatgacaaagaagaatttctgc
atagggacagggcacctcctggcaaaaattctggcttccactttgcagcgctttaaagat
gttgctgaggtgcagactacaggattacagacaaccctgtcaatacttgagctgtcagta
tctttctccaagctgctagtgcactattcctttgatgtggtgatatttcatcagatgtct
tccagtgttgtagaacaaaaggatgagcagttcctcaatctatgttgcaaatgctttgca
aaagtggccgtggatgatgagctgaaaaacaccatgctagagagagcctgcgatcagaat
aacagcatcatggttgaatgtttgctcctcttgggagctgatgccaaccaagtgaagggg
gcaacttctttaatctatcaggtatgtgagaaagagagcagtcctaaattggtggaactg
ttgcttaatggtggttgtcgtgaacaagatgtacggaaggccctgaccgtaagcatccaa
aagggcgacagccaggtcatcagcttgctcctcaggaaacttgccctggacctggccaac
aacagcatttgccttggaggatttggcataggaaaaattgatccttcttggcttggtcct
ttatttccagataagtcatccaatttaaggaagcaaacaaacacaggatctgtcctagcg
aggaaagtgctccggtatcagatgagaaacacccttcaagaaggcgtggcctcaggcagt
gacggcaagttttctgaagacgcgctggcgaaatttggagaatggacctttattcccgac
tcttctatggacagtgtgtttggccagagcgatgatctggatagcgaaggcagcgagagc
tcatttctcgtgaagaggaagtccaactcaattagtgtaggggaagtttacagagatcta
gctctgcagcgctgctcaccaaatgctcagaggcattccaattcgctgggtcctgttttt
gaccatgaagacttactgagacgaaaaagaaaaatactgtcttcagatgagtctctcagg
tcctcaaggctgccgtcccatatgaggcaatcagatagctcttcttccctggcttctgag
agagaacacatcacgtcgttagacctatctgccaacgaactcaaagatattgatgctctg
agccagaagtgttgcctcagtagccacctggaacatctcaccaaactggaacttcaccag
aattcactcacgagcttcccacagcagctgtgtgagactctgaagtgtttgatacacttg
gatttgcacagtaacaaattcacctcatttccctctttcgtgttgaaaatgccacgtatc
accaacctagatgcctctcgaaatgacatcgggccaacagtagttttagaccctgcgatg
aagtgtccaagcctcaaacagttgaatctgtcctataaccagctctcttcaatcccagag
aatcttgcccaagtggtggagaaacttgagcagctcctactggaaggaaataaaatatcc
gggatttgctctcccctgagcctgaaggaactgaagattttaaatcttagtaaaaatcac
attccatccctacctggagattttcttgaggcttgttcaaaagtcgagagtttcagtgct
cgcatgaattttcttgctgcaatgcctgccttaccttcttccataacgagcttaaaattg
tctcagaactctttcacgtgcattccagaagcgattttcagtcttccgcacttgcggtcc
ttggatatgagccacaacaacattgaatgtctgccgggacctgcacattggaagtctctg
aacttaagggaactcatttttagcaagaatcagatcagcaccttagactttagtgagaac
ccacacgtgtggtcaagagtagagaaactgcatctctctcataataaactgaaagagatt
cctccagaaattggctgccttgaaaatctgacgtctctcgacgtcagttacaacttggaa
ctgaggtccttcccaaatgaaatggggaagttgagcaagatatgggatcttcccttggac
ggactgcatctgaattttgactttaagcacgtaggatgcaaggccaaagacatcataagg
tttctacaacaacgtctgaaaaaggctgtaccctacaaccgaatgaagctcatgattgtg
ggaaatacggggagcggtaagaccactttactgcaacaactcatgaaaatgaagaaacca
gaacttggcatgcagggtgccacagtcggcatagacgtgcgagactggtccatccaaata
cggggcaaaaggagaaaggacctggttctaaacgtgtgggattttgcaggtcgtgaggaa
ttctacagcactcacccccacttcatgacccagagagccctctacctggctgtctatgat
ctcagcaaggggcaggcagaggtggacgccatgaagccctggctcttcaatatcaaggct
cgtgcctcttcttccccggtgattctggtgggcacacatttggatgtttctgatgagaag
cagcggaaagcgtgcataagcaaaatcacgaaggaactcctaaataagcgaggattcccc
accatccgggactaccactttgtgaatgccaccgaggagtcagatgcgctggcaaagctt
cggaaaaccatcataaatgagagccttaatttcaagatccgagatcagcctgtggttggg
cagctaattccagattgctacgtagaactggagaaaatcattttatcagagcggaaagct
gtgccgactgagtttcctgtgattaaccggaaacacctgttacagctcgtgaacgaacat
cagctgcagctggatgagaacgagctcccacacgccgttcacttcctaaatgagtcggga
gttcttctgcattttcaagaccctgccctgcagctaagtgacctgtactttgtggaaccc
aagtggctttgtaaagtcatggcacagatcttgacagtgaaggtagacggctgtctgaaa
catcctaagggcatcatttcccggagagatgtggaaaaattcctttcaaagaagaagcga
ttcccgaagaactatatgatgcaatactttaaactattagaaaaatttcagatcgcattg
ccaataggggaagaatatcttctggttccaagcagcttgtctgaccacaggccagtgata
gagctcccccactgtgagaactctgagatcatcatccggctgtacgaaatgccgtacttt
cccatgggattttggtcaagattgattaaccgattacttgaaatctcacccttcatgctt
tctggcagagagagagcactacgccctaacaggatgtattggcggcaaggcatctacttg
aattggtctccagaagcatactgtctggtaggctctgaagtcttagacaatcgacctgag
agtttcttgaaaatcacagttccgtcttgtagaaaaggttgtattcttctgggccgagtt
gtggatcatattgactcactcatggaagaatggtttcccgggttactggagattgacatt
tgtggggaaggagaaactctgttgaagaaatgggcattgtacagttttaatgatggtgaa
gaacatcagaagatcttgcttgatgagttgatgaagaaggctgaagaaggagacctgtta
ataaatccagaccaaccaaggctcactattccaatatcccagattgctccggacttgatc
ttggctgacctgcctagaaatatcatgttgaacaatgatgagttggaatttgaggaagca
ccagagtttctcttaggcgatggaagttttggatccgtttatcgagctgcctacgaagga
gaggaagtggctgtgaagatttttaataagcacacatctcttaggctgttaagacaagag
ttggtggtcctttgtcaccttcaccaccccagcctgatatccttgctggcggctggtatt
cgtcctcggatgttggtaatggagttggcctccaaaggttccttggatcgcctgctgcag
caggacaaagccagcctcaccagaaccctccagcacaggatcgcgttgcatgtggccgac
ggcctgaggtatctccactcagccatgattatttaccgtgacctgaagccccacaatgtg
ctgctttttaccctgtatcccaatgctgccatcattgcgaagattgcggactacgggatc
gcacagtactgctgcaggatgggaataaagacatcagagggcaccccagggttccgggca
cctgaagttgccagggggaatgtcatttataaccaacaggccgatgtttattcttttggc
ttactacttcacgatatttggacaactgggagtaggattatggagggtttgaggttccca
aatgagtttgatgagttagccatacaagggaagttgccagatccagttaaagaatatggc
tgtgccccatggcctatggttgagaagttaattacaaagtgtttgaaagaaaatcctcaa
gaaagacccacttctgcccaggtctttgacattttgaattcggctgaattaatttgcctc
atgcgacacattttaatacctaagaacatcattgttgaatgcatggttgccacgaatctc
aatagcaagagtgcgactctctggttgggatgtgggaacacagaaaaaggacagctttcc
ttatttgacttaaacacggaaagatacagctatgaggaagttgctgatagtagaatactg
tgcttggctttggtgcatctcgctgctgagaaagagagctgggttgtgtgcgggacacag
tctggggctctcctggtcatcaatgttgaagaggagacaaagagacacaccctggaaaag
atgactgattctgtcacttgtttgcattgcaattcccttgccaagcagagcaagcaaagt
aactttcttttggtgggaactgctgatggtaacttaatgatatttgaagataaagccgtt
aagtgtaaaggagctgcccccttgaagacactacacataggcgatgtcagtacgcccctg
atgtgcctgagcgagtccctgaattcatctgaaagacacatcacatggggagggtgtggc
acaaaggtcttctccttttccaatgatttcaccattcagaaactcatcgagacaaaaacc
aaccagctgttttcttacgcagctttcagcgattctaacatcatagcgctggcagtagac
acagccctgtatattgccaagaaaaacagccctgtcgtagaggtgtgggacaagaaaaca
gaaaagctctgtgaattaatagactgtgtgcacttcttaaaggaggtgatggtaaaacta
aacaaggaatcgaaacatcagctgtcctactctgggagggtgaaggccctctgcctgcag
aagaacacggctctctggatcggaactggaggaggccacatcttactcctggatctttct
actcggcgagttatccgcaccattcacaatttctgtgattctgtgagagccatggccaca
gcacaattaggaagccttaagaatgtcatgctggttttggggtacaagcggaagagtaca
gagggtatccaagaacaaaaagagatacaatcttgtttgtctatttgggacctcaatctt
ccacacgaggtgcaaaatttagaaaaacacattgaagtaagaacagaattagctgataaa
atgaggaaaacatctgttgaatag

DBGET integrated database retrieval system