KEGG   Mus musculus (mouse): 66848Help
Entry
66848             CDS       T01002                                 

Gene name
Fuca2, 0610025O11Rik, 5530401P20Rik
Definition
fucosidase, alpha-L- 2, plasma (EC:3.2.1.51)
Orthology
K01206  
alpha-L-fucosidase [EC:3.2.1.51]
Organism
mmu  Mus musculus (mouse)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    66848 (Fuca2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     66848 (Fuca2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   66848 (Fuca2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
10 A2; 10
AA seq 461 aa AA seqDB search
MRLGFLMLLPLLLLPLLRPWGVTRALSYDPTWESLDRRPLPAWFDQAKFGIFIHWGVFSV
PSFGSEWFWWYWQKEKKPQFVDFMNNNYAPGFKYEDFVVLFTAKYFNANQWADILQASGA
KYVVFTSKHHEGFTMWGSDRSWNWNAVDEGPKRDIVKELEVAVRNRTGLHFGLYYSLFEW
FHPLFLEDQSSSFQKQRFPVSKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAW
LYNESPVRKTVVTNDRWGVGSICKHGGYYTCSDRYNPGYLLPHKWENCMTIDKFSWGYRR
EAEISDYLTIEELVKKLVETVACGGNLLMNIGPTGDGTIPVIFEERLRQMGTWLKVNGEA
IYETHTWRSQNDTVTPDVWYTSKPEKKLVYAIFLKWPISGKLFLGQPIGSLGETEVELLG
HWQPLTWTSSQPSGITVELPLLSVHQMPCKWGWTLVLSNVI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctggggttcctgatgcttctgccgctgctgctgctgccgctcctgaggccttgg
ggggtcacgagagcccttagctatgaccccacttgggaatctctggacagacgcccgctg
ccagcctggttcgaccaggccaagttcggcatctttatccactggggagtgttctccgtg
cccagctttggtagtgaatggttctggtggtattggcaaaaggagaagaaaccccagttt
gtggactttatgaacaataattatgctcctggttttaagtatgaagattttgtagtgcta
tttacagccaagtattttaatgcaaaccagtgggcagatattctccaggcctctggtgcc
aaatatgtggtcttcacttctaaacatcacgaaggctttacaatgtggggctcagaccgt
tcttggaactggaatgcagtcgatgaggggccaaagagggacattgtcaaggagcttgag
gtggctgtgaggaacaggactggcttgcactttggtctgtactattctctttttgaatgg
ttccatccgctctttctggaggatcagtccagctcattccaaaagcagcgatttcccgtt
tctaagacattgcctgagctctatgagttggtgaacagataccagcctgaagtcctgtgg
tcagacggagatgggggcgcgccagatcactactggaacagcactggcttcttagcctgg
ctgtataatgaaagcccagttcggaaaacagtagtcaccaatgatcgctggggagtcggg
tctatctgcaaacatggtggctactatacttgcagtgaccgttacaatcctggctatctc
ttgccacacaaatgggaaaactgcatgacaatagataagttctcctggggctacaggcgg
gaagctgaaatcagtgattatcttacaattgaagagttggtgaagaaacttgtggaaaca
gtcgcatgtggtggaaatcttttgatgaatattggtcccacgggagacggcaccattcct
gtcatttttgaggagcgattaaggcaaatgggaacctggctgaaggtcaacggggaagct
atttatgaaacacacacttggaggtctcagaatgacactgtcactccggatgtgtggtac
acatctaaacccgagaagaaattagtctatgctatttttcttaaatggcccatctctgga
aagctgtttcttggacaacccataggtagtctgggggaaacagaggtagaactgctgggc
cattggcagccactgacttggacatcttcacagcccagtggcatcaccgtggagttacct
ctgctcagcgtacatcagatgccctgtaaatggggatggactcttgtgctaagtaatgtg
atttaa

DBGET integrated database retrieval system