KEGG   Mus musculus (mouse): 67379Help
Entry
67379             CDS       T01002                                 

Gene name
Dedd2, 2410050E11Rik, FLAME-3
Definition
(RefSeq) death effector domain-containing DNA binding protein 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 A3
AA seq 330 aa AA seqDB search
MALSGSTPAPSWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAPGGLA
RARSGLELLLELERRGQCDESNLRLLSQLLRVLARHDLLPHLARKRRRPVSPERYSYGNP
SSSSKRTEDSCRRRRQASSSSDSPQSQWDTGSPPTKRQRRSRGRPSSGARQRRRAGLAAS
QQHQQHQELGRPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQAT
AVLRSRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVRLL
VSVDEADYEAGRRRLLLMEEEGGRRGTEAS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgtccgggtcgaccccggccccgagctgggaggaggatgagtgtttggattac
tacggcatgctgtcgcttcaccgtatgttcgaggtagtgggcgggcagctgaccgagtgc
gaactggagctcctggccttcctgctggatgaggcccccggcgcccccggcggcctggcc
cgcgcccgcagcggcctggagctgcttctggagctggaacgccgcgggcagtgcgacgag
agcaacctgcggctgctgagccaactcctgcgcgtgctagcccgtcacgacctcctgcca
catctggcgcgcaagcggcgccggccagtgtcccctgagcgatacagctatggcaatccc
agctcttcttccaagaggacagaggacagttgccggcgtcggcgacaggcgagcagttct
tcggactctcctcagagtcagtgggacacaggctccccaccaaccaagcggcagcggcgg
agtcggggccgccctagcagtggtgcccggcagcggcggagagcaggccttgcagcctcg
cagcagcaccagcagcaccaggagttgggcaggccctcctcagaaggcaaggtgacctgt
gacatccggctccgggttcgggcagagtactgcgagcatgggccagccttggagcagggt
gtggcgtcccggagacctcaggcgttggcccggcagctggatgtgtttggacaagccact
gctgtgctgcggtcaagggacctgggctctgtggtgtgtgacatcaagttctcagagctg
tcctatctggacgccttctggggcgactacctgagtggcgccctgctgcaggcccttcgg
ggcgtgttcctgactgaggctttacgggaggccgtgggccgagaggctgtccgcttgctg
gtcagtgtggacgaggctgactatgaggctggccggcgtcgcctgttgctgatggaggag
gaaggagggcggcgtgggaccgaggcctcctga

DBGET integrated database retrieval system