KEGG   Mus musculus (mouse): 72469Help
Entry
72469             CDS       T01002                                 

Gene name
Plcd3, 2610205J15Rik, mKIAA1964
Definition
phospholipase C, delta 3 (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mmu00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mmu04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:mmu04070]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mmu04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E1; 11 66.71 cM
AA seq 785 aa AA seqDB search
MLCGGWKRSRRSPEESRVSAQVAAPLAFPPSPASSDSSTKRPGLRALKKMGLTEDEDVQA
MLRGSRLLKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAASKHIFFVQHIEAVREGHQSE
GLRRFGGAFAPACCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLAKLRARLDAMSQRERLD
HWIHSYLHRADSDQDSKMSFKEIKSLLRMVNVDMNDMYAYRLFKECDHSNNERLEGAEIE
AFLRRLLKRPELEEIFRRYSGEDRVLSASELLEFLEDQGEDGATLACAQQLIQTYELNET
AKQHELMTLDGFMMYLLSPEGAALNVAHTCVFQDMGQPLAHYFISSSHNTYLTDSQIGGT
SSTEAYIRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVIQAVRDHAFTSSPY
PVILSLENHCGLEQQAVMARHLRSILGDMLVTQALDSQNPEELPSPEQLKGRILVKGKKL
PAARSEDGRILSDREEEEEEEEEAEEALEAAEQRSRAKQISPELSALAVYCCATRLRTLD
PSPGPPQSCTVGSLSERKARKFTREAGTSFVRHNTQQLTRVYPLGLRMNSANYNPQEMWN
SGCQLVALNFQTPGYEMDLNTGRFLINGQCGYVLKPAYLRQLNTTFDPECPGPPRTTLAI
QVLTAQQLPKLNAEKPSSIVDPLVRVEIHGVPEDCAQKETDYVLNNGFNPCWEQTLQFRL
RAPELVLVRFVVEDYDTTSPNDFVGQSTLPLSSLKQGYRHIHLLSKDGASLAPATLFVHI
RIQNS
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcggtggctggaaaaggagtcgccgctcgccggaggaatcccgggtgtccgcc
caggtcgcagcgcccctcgcgttcccgccctcgcccgcgtcgtcggacagcagcaccaaa
aggcctgggctacgggcactgaagaagatgggcctgacggaggatgaggatgtccaagcc
atgctgcggggctcccgactcctcaagatccgctcacgcacgtggcacaaggagcggctg
taccggctgcaggaggacggcctgagcgtgtggtttcagcggcgcatccctcgcgcagct
tctaagcacatattcttcgtgcagcacatcgaggctgtccgggagggtcatcagtcggag
ggcctgcggcgcttcgggggcgccttcgcgccagcgtgctgcctcaccatcgccttcaag
ggccgccgcaagaacctggacctggcagcgcccactgcggaggaggcacagcgctgggtg
cgaggactggccaagctgcgggcgcgcctggatgccatgagccagcgggagcgcctagac
cattggatccattcctatctgcaccgggccgactccgaccaagacagtaagatgagcttc
aaggagatcaagagcctgctgaggatggtgaacgtggacatgaacgacatgtacgcttac
cgcctcttcaaggagtgtgaccattccaacaacgagcgtctagagggggccgagatagag
gcgttcctgcggaggctgctaaagcggcctgagctggaggagatcttccgccggtactcc
ggtgaggaccgggtgctgagtgcctctgagctgctggagttcctggaagaccagggcgag
gatggtgccaccctggcctgtgcccagcagcttatccagacttatgagctcaatgagaca
gccaagcagcacgaactgatgacgctggatggcttcatgatgtatctgttgtcgcctgag
ggggccgccctgaacgtggcccacacgtgtgtgttccaggacatgggtcagcccctcgcc
cactactttatctcgtcctctcacaatacctacctgacggactctcagatcggagggacc
agcagcacagaggcttatattagggcctttgcccagggatgccgctgtgtggaacttgac
tgctgggaggggccgggaggggaacctgtcatctaccatggccacacgctcacctccaag
atcctctttcgagatgtgatccaggctgtgcgtgaccacgctttcacgtcgtccccatat
cctgtaatcctatccctcgagaaccactgcgggctggaacagcaggctgtcatggctcgc
caccttcgaagcatcctgggagacatgctggtgacacaggccctggactcccagaacccc
gaggagctgccatctcctgagcagctcaagggccggatcttggtgaaggggaagaagctg
ccagctgctcggagtgaggatggtcgaattctgtcagacagggaggaggaagaggaggag
gaagaggaggcggaagaggccttggaagctgcagagcagaggagtcgagccaagcagatc
tccccagagctctcagcgctggctgtgtattgctgtgctacccgcctgcggaccctggat
cccagtcctggcccgcctcagtcttgcacggttggctccctcagcgagcgcaaggccagg
aagttcaccagggaggcagggaccagctttgtcaggcacaacactcagcaactgacccga
gtgtacccactggggctgcggatgaactcagccaactataacccccaggagatgtggaac
tccggctgtcagctggtggctctgaactttcagactcctggttatgagatggacctcaac
acagggcgcttcctcataaacgggcaatgtggctacgtcctcaaacctgcttacctcagg
caactcaacaccacctttgaccctgagtgccctggaccccccagaactactctggcaatc
caggtgttaacggcccagcagctacccaagctgaacgcagagaagcccagctccattgtg
gatcctctggtgcgcgtggagatccacggggtgcccgaagactgtgcccagaaggagaca
gactacgtcctcaacaatggcttcaacccctgctgggagcagactctgcagttccgactg
cgggccccagagctggtgctggtcaggtttgtggtagaagattatgacaccacctctccc
aatgattttgtgggccagtctacactgcctctcagcagcctgaagcaagggtaccgccac
atccacctgctgtccaaggatggagcctcgctcgctccagccacgctcttcgtgcacatc
cgcattcagaactcttga

DBGET integrated database retrieval system