KEGG   Mus musculus (mouse): 72469Help
Entry
72469             CDS       T01002                                 

Gene name
Plcd3, 2610205J15Rik, mKIAA1964
Definition
phospholipase C, delta 3 (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    72469 (Plcd3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    72469 (Plcd3)
   04070 Phosphatidylinositol signaling system
    72469 (Plcd3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    72469 (Plcd3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     72469 (Plcd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E1; 11 66.71 cM
AA seq 785 aa AA seqDB search
MLCGGWKRSRRSPEESRVSAQVAAPLAFPPSPASSDSSTKRPGLRALKKMGLTEDEDVQA
MLRGSRLLKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAASKHIFFVQHIEAVREGHQSE
GLRRFGGAFAPACCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLAKLRARLDAMSQRERLD
HWIHSYLHRADSDQDSKMSFKEIKSLLRMVNVDMNDMYAYRLFKECDHSNNERLEGAEIE
AFLRRLLKRPELEEIFRRYSGEDRVLSASELLEFLEDQGEDGATLACAQQLIQTYELNET
AKQHELMTLDGFMMYLLSPEGAALNVAHTCVFQDMGQPLAHYFISSSHNTYLTDSQIGGT
SSTEAYIRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVIQAVRDHAFTSSPY
PVILSLENHCGLEQQAVMARHLRSILGDMLVTQALDSQNPEELPSPEQLKGRILVKGKKL
PAARSEDGRILSDREEEEEEEEEAEEALEAAEQRSRAKQISPELSALAVYCCATRLRTLD
PSPGPPQSCTVGSLSERKARKFTREAGTSFVRHNTQQLTRVYPLGLRMNSANYNPQEMWN
SGCQLVALNFQTPGYEMDLNTGRFLINGQCGYVLKPAYLRQLNTTFDPECPGPPRTTLAI
QVLTAQQLPKLNAEKPSSIVDPLVRVEIHGVPEDCAQKETDYVLNNGFNPCWEQTLQFRL
RAPELVLVRFVVEDYDTTSPNDFVGQSTLPLSSLKQGYRHIHLLSKDGASLAPATLFVHI
RIQNS
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcggtggctggaaaaggagtcgccgctcgccggaggaatcccgggtgtccgcc
caggtcgcagcgcccctcgcgttcccgccctcgcccgcgtcgtcggacagcagcaccaaa
aggcctgggctacgggcactgaagaagatgggcctgacggaggatgaggatgtccaagcc
atgctgcggggctcccgactcctcaagatccgctcacgcacgtggcacaaggagcggctg
taccggctgcaggaggacggcctgagcgtgtggtttcagcggcgcatccctcgcgcagct
tctaagcacatattcttcgtgcagcacatcgaggctgtccgggagggtcatcagtcggag
ggcctgcggcgcttcgggggcgccttcgcgccagcgtgctgcctcaccatcgccttcaag
ggccgccgcaagaacctggacctggcagcgcccactgcggaggaggcacagcgctgggtg
cgaggactggccaagctgcgggcgcgcctggatgccatgagccagcgggagcgcctagac
cattggatccattcctatctgcaccgggccgactccgaccaagacagtaagatgagcttc
aaggagatcaagagcctgctgaggatggtgaacgtggacatgaacgacatgtacgcttac
cgcctcttcaaggagtgtgaccattccaacaacgagcgtctagagggggccgagatagag
gcgttcctgcggaggctgctaaagcggcctgagctggaggagatcttccgccggtactcc
ggtgaggaccgggtgctgagtgcctctgagctgctggagttcctggaagaccagggcgag
gatggtgccaccctggcctgtgcccagcagcttatccagacttatgagctcaatgagaca
gccaagcagcacgaactgatgacgctggatggcttcatgatgtatctgttgtcgcctgag
ggggccgccctgaacgtggcccacacgtgtgtgttccaggacatgggtcagcccctcgcc
cactactttatctcgtcctctcacaatacctacctgacggactctcagatcggagggacc
agcagcacagaggcttatattagggcctttgcccagggatgccgctgtgtggaacttgac
tgctgggaggggccgggaggggaacctgtcatctaccatggccacacgctcacctccaag
atcctctttcgagatgtgatccaggctgtgcgtgaccacgctttcacgtcgtccccatat
cctgtaatcctatccctcgagaaccactgcgggctggaacagcaggctgtcatggctcgc
caccttcgaagcatcctgggagacatgctggtgacacaggccctggactcccagaacccc
gaggagctgccatctcctgagcagctcaagggccggatcttggtgaaggggaagaagctg
ccagctgctcggagtgaggatggtcgaattctgtcagacagggaggaggaagaggaggag
gaagaggaggcggaagaggccttggaagctgcagagcagaggagtcgagccaagcagatc
tccccagagctctcagcgctggctgtgtattgctgtgctacccgcctgcggaccctggat
cccagtcctggcccgcctcagtcttgcacggttggctccctcagcgagcgcaaggccagg
aagttcaccagggaggcagggaccagctttgtcaggcacaacactcagcaactgacccga
gtgtacccactggggctgcggatgaactcagccaactataacccccaggagatgtggaac
tccggctgtcagctggtggctctgaactttcagactcctggttatgagatggacctcaac
acagggcgcttcctcataaacgggcaatgtggctacgtcctcaaacctgcttacctcagg
caactcaacaccacctttgaccctgagtgccctggaccccccagaactactctggcaatc
caggtgttaacggcccagcagctacccaagctgaacgcagagaagcccagctccattgtg
gatcctctggtgcgcgtggagatccacggggtgcccgaagactgtgcccagaaggagaca
gactacgtcctcaacaatggcttcaacccctgctgggagcagactctgcagttccgactg
cgggccccagagctggtgctggtcaggtttgtggtagaagattatgacaccacctctccc
aatgattttgtgggccagtctacactgcctctcagcagcctgaagcaagggtaccgccac
atccacctgctgtccaaggatggagcctcgctcgctccagccacgctcttcgtgcacatc
cgcattcagaactcttga

DBGET integrated database retrieval system