KEGG   Mus musculus (mouse): 74055Help
Entry
74055             CDS       T01002                                 

Gene name
Plce1, 4933403A21Rik, PLCepsilon, Plce, mKIAA1516
Definition
phospholipase C, epsilon 1 (EC:3.1.4.11)
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    74055 (Plce1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    74055 (Plce1)
   04015 Rap1 signaling pathway
    74055 (Plce1)
   04020 Calcium signaling pathway
    74055 (Plce1)
   04070 Phosphatidylinositol signaling system
    74055 (Plce1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    74055 (Plce1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    74055 (Plce1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     74055 (Plce1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 D1; 19
AA seq 2282 aa AA seqDB search
MTSEEMAASVLIPVTQRKVASAQSVAEERSVKVSDAGIPRARAGRQGALIPPTISQWNKH
KEESSRSDLSKVFSIARGELVCDENSNEEGWEENAPDSPENHAMNGNSLVQSHQHQFPRS
QLCEARDSVTEDPCLQPGIPSPLERKVLPGIQLEMEDSPMDVSPAGSQPRIMESSGPHSD
RNTAVFHFHYEADRTMSDAFHTLSENLILDDCANCVTLPGGQQNKNCMAYACKLVELTRT
CGSKNGQVQCEHCTSLRDEYLCFESSCSKADEVCSGGGFCEDGFAHGPAAKTFLNPLEDF
SDNCEDVDDFFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIMRTLPSGCIGPAAWNYV
DQKKAGLLWPCGNVMGTLSAMDIRQSGSQRLSEAQWCLIYSAVRRGEEIEDTVGSLLHCS
TQLPNSETAHGRIEDGPCLKQCVRDTECEFRATLQRTSIAQYITGSLLEATTSLGARSGL
LSSFGGSTGRIMLKERQLGTSMANSNPVPSSSAGISKELIDLQPLIQFPEEVASILTEQE
QNIYRRVLPMDYLCFLTRDLSSPECQRSLPRLKASISESILTSQSGEHNALEDLVMRFNE
VSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFM
DQSDIETMRSLKDAMAQHESSVEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGL
LKLCPRYSSQEEALEFVADYSGQDNFLQRVGQNGLKNSEKELTVNSIFQVIRSCSRSLEM
EEEDSASEGSGSRKNSLKDKARWQFIIGDLLDSENDIFEKSKECDPHGSEESQKAFDHGT
ELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWMKPPTASPAG
ARPKLGVLSNMAEPGKFPSPGNAGVSGLAEGILDLFSVKAVYMGHPGIDIHTVCVQNKLS
SMLLSETGVTLLYGLQTTDNRLLHFVAPKHTAEMLFSGLLELTTAVRKIRRFPDQRQQWL
RKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGMSAKNAEKPNMQRNNTLGIST
TKKKKKMLMRGESGEVTDDEMATRKAKMYRECRSRSGSDPQDVNEQEESEANVITNPPNP
LHSRRAYSLTTAGSPNLATGMSSPISAWSSSSWHGRIRGGMQGFQSFMVSDSNMSFVEFV
ELFKSFSIRSRKDLKDIFDIYSVPCNRSASESAPLYTNLTIEENTSDLQPDLDLLTRNVS
DLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLNDFLVNCQGE
HCTYDEILSIIQKFEPSVSMCHQGLLSFEGFARFLMDKDNFASKNDESRENKKELQLPLS
YYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSIELDCWDGDDGMPIIYHGHTLTTK
IPFKEVVEAIDRSAFITSDLPIIISIENHCSLPQQRKMAEIFKSVFGEKLVAKFLFETDF
SDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQAQAFTGGNANPPPASN
EEEEDEEDEYDYDYESLSDDNILEDRPENKSCADKLQFEYNEEVPKRIKKADNSSGNKGK
VYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNSSGSSRGKERKSRKS
IFGNNPGRMSPGETAPFNRTSGKGSCEGMRHTWEESSPLSPSTSLSAIIRTPKCYHISSL
NENAAKRLCRRGSQKLIQHTAYQLLRTYPAATRIDSSNPNPIMFWLHGIQLVALNYQTDD
LPLHLNAAMFEANGGCGYVLKPPVLWDKSCPMYQKFSPLERDLDNLDPAIYSLTIISGQN
VCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAV
VENNSSAITAQRIIPLRALKRGYRHLQLRNLHNEILEISSLFINSRRMEENPSGSSMPAS
LMFNTEERKCSQTHKVTVHGVPGPEPFAVFTINEGTKAKQLLQQVLAVDQDTKCTATDYF
LMEEKHFISKEKNECRKQPFQRAVGPEEDIVQILNSWFPEEGYVGRIVLKPQQETLEEKS
IVFDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILN
NPNPCDYVLLEEVLKDAANKKSSTPKSSQRILLDQECVFQAQSKWKGAGKFILKLKEQVQ
ASREDKRRGISFASELKKLTKSTKQSRGLPSPPQLVASESVQSKEEKPVGALSSSDTVGY
QQ
NT seq 6849 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggaagaaatggccgcttctgtcctcatccctgtgactcaaaggaaagtggct
tctgcccagtcggtggcagaagagaggagtgtaaaggtctcagatgcggggattcctcgg
gcacgtgctggcaggcagggtgcgctcatccctcctaccatctcacagtggaacaaacat
aaggaagagtcgtctagaagtgatttgtccaaggtcttctcaatagcgaggggggaacta
gtctgcgatgagaattccaacgaagagggctgggaggaaaacgcaccggactccccggaa
aaccacgcgatgaacggcaacagtttagtgcaaagccaccagcaccagtttccccggagc
cagctttgtgaagcccgtgactctgtcacagaagacccgtgtttgcagcctggaattcct
tctcccctggaaaggaaggtgctccctggaattcaactggagatggaggactctcccatg
gacgtgagccctgcgggaagtcagcctaggatcatggagtccagcggacctcactctgac
cgcaacacggcggtatttcacttccattatgaagctgacaggacaatgtcggatgctttt
cataccctgtcagaaaacctgattttggatgactgtgcaaattgtgttactcttcctggg
gggcagcaaaataaaaattgcatggcgtatgcttgcaaactggtggagttgacaagaacc
tgtggaagtaagaatgggcaagtccagtgtgagcactgtacctcgctgcgcgatgaatac
ctgtgcttcgaaagctcctgctcaaaggccgatgaggtctgctcaggtggtggcttttgc
gaggacggctttgctcacggtcctgctgccaagacttttctgaaccctctggaggatttc
tctgacaattgtgaagacgtagacgatttttttaaaagcaaaaaggagcggtccacgttg
ttagtccgaaggttttgtaaaaatgacagggaagttaagaagtctgtgtatactgggacc
agagccatcatgagaactctgccttctggctgtattgggccagctgcttggaattacgtt
gatcagaagaaagctggtctcctatggccttgtgggaatgtaatgggaactctgtcagca
atggacataaggcaaagtgggagccaacgtctgtctgaagcccagtggtgcctgatctac
agtgccgtgagaagaggggaagaaatagaagatacggttggatctcttctccattgctcc
acacagctcccaaactctgagacagcccatggaaggattgaagatggtccctgcttaaag
cagtgtgtacgagacactgaatgtgaattccgtgctaccctccaaaggacatccatagct
cagtacatcaccggttctcttctagaggcaactacatctttaggagcaagaagtggcctt
ctcagttccttcggaggatccactggacgaataatgctgaaagaacgccaactgggcacc
tctatggccaattccaatcctgttccttcaagttcagctggaatcagcaaggagctgatt
gatctccagcccctcattcagttcccggaggaagtagccagcatcttaacagagcaggaa
cagaacatttaccgcagggtcctgcccatggactacctctgcttcttaacccgggacttg
agttcacctgaatgccagagatcactgccccgtctcaaagcatccatctcagaatccatc
ctcacgtctcaaagtggagaacacaatgcccttgaagaccttgtgatgagatttaacgag
gtgagctcctgggtaacatggctgatcctcacagcaggctccatggaggagaagcgggaa
gtcttttcttatttggtgcatgtggccaaatgctgctggaacatgggcaactacaacgct
gtcatggagttcctggctggcctcaggtcaaggaaagttctaaagatgtggcagttcatg
gaccagtctgacattgagaccatgcggagcctgaaggatgccatggcccagcatgagtct
tccgtggagtacaagaaggtagtgacccgagccttgcacatccccggctgcaaagtggtc
cccttctgtggggtgttcctgaaggagctctgtgaggtgcttgatggtgcctctggcctc
ctgaagctctgcccacggtacagctcccaagaagaagctctggagtttgtagccgattac
agtggacaagataacttcttacaacgagtgggacagaatggcttaaagaattcagagaag
gagctcacggtcaacagcatctttcaggtcatccggagctgcagccgaagtttggagatg
gaggaggaagacagtgccagtgaagggagcggctctaggaaaaactccctgaaggacaaa
gcccgatggcagtttataattggagatttgctggattcagaaaatgacatctttgagaag
tccaaagagtgtgacccccatggatccgaggagtcacagaaagcctttgaccatgggaca
gagcttatcccatggtacgtgctgtccatccaagcagatgtgcaccagttcctattgcag
ggggccacagtcatccactatgaccaggacacacatctctcggcccgctgctttctccag
ttgcagcctgacaatagcacgttgacctggatgaaacctcccactgcctccccagcaggc
gccagacccaagctcggtgtgcttagtaacatggccgagcctggcaagttcccatcccca
ggcaacgccggggtgagcggcctggcagagggaattctggatctgttctcagtgaaggct
gtgtacatgggacaccctggcattgatatacacactgtgtgtgtccagaacaaacttagt
agcatgcttctatcggagacgggggtcacactgctctatgggcttcagaccacggacaat
agattactgcactttgtggcgccaaagcacacggctgagatgcttttcagtggattgctg
gaactcactacagctgtgagaaagataaggaggttccctgaccaacgacagcagtggctt
cggaaacagtatgtcagcctctatcaggaggatggtcggtatgaaggcccaaccttggca
catgctgtggagttgtttggtggtaggcggtggagcactagaaaccccagccctggaatg
tcagcaaagaatgctgagaagcccaacatgcagagaaacaacaccctgggcataagcacc
accaagaaaaagaagaaaatgctcatgaggggagagagtggagaggtgacggacgatgag
atggctacccgcaaggccaaaatgtacagagagtgtcgcagccggagcggctctgatcct
caagacgttaacgaacaagaagagtcggaggccaatgtcatcactaaccctcccaacccc
ctccattccagaagagcctactctttgaccacggctgggtcccccaacttggctaccggg
atgtcatctcccatcagtgcctggagcagcagcagctggcatgggcgaatccgaggagga
atgcaaggcttccagagcttcatggtctcagacagtaacatgagtttcgttgaattcgtc
gagctgttcaaatcattcagcatcaggagccgcaaggacttgaaggacatctttgacatc
tactctgtaccctgcaatcggtctgcctcggagtcagccccactctacaccaacctgaca
atcgaagaaaataccagcgatcttcagcctgacctagatttgctgactagaaacgtctcc
gacctggggctgttcattaaaagtaaacagcagctttctgacaaccagaggcagatatct
gatgctatcgctgctgcaagcatcgtgaccaatggtactgggattgaaagcacgtccctg
ggcatatttggggtcggcatactccagctcaatgacttcctggtgaattgccaaggagaa
cactgcacatatgatgaaatcctgagcatcatccagaaatttgagcctagcgtcagcatg
tgtcatcaaggcctactgtcatttgaagggtttgcaaggtttctgatggataaagacaat
ttcgcctcaaaaaatgatgagtcacgggagaacaagaaagaactgcagctacccctctcc
tactattatatagaatcttcacacaacacctacctcaccggccatcagctcaagggggag
tcctctgtggagctctatagccaggtcctcctgcaaggatgtagaagcatagagctggac
tgctgggacggggatgatgggatgcccatcatctatcatgggcatacactgacaaccaag
atccccttcaaggaagtggtggaagccatcgatcgcagtgccttcatcacctcagacctg
ccaatcatcatatccattgagaaccattgttcattgcctcaacaacgaaaaatggcagaa
attttcaagagtgtgtttggagaaaagctggtggctaagttcttattcgagaccgatttc
tcagatgacccaatgcttccctcacctgatcaacttagaaggaaagtactccttaaaaac
aagaagctaaaggcccatcagacacctgtcgacatcctaaaacaaaaggctcatcagtta
gcatccatgcaagcacaggctttcaccggtgggaatgccaacccgccacctgccagtaat
gaggaagaggaagatgaggaggatgaatatgattacgattacgagtccctgtccgatgac
aatattctggaagacagacctgagaacaaatcatgcgctgacaagcttcagtttgagtac
aatgaagaggtccccaagaggataaagaaagcagacaactcctctggcaataagggaaag
gtgtatgacatggaactgggagaggagttttaccttcctcagaacaaaaaggaaagcagg
cagattgcaccggagctttctgacctcgtcatttattgccaggcagtaaaatttccaggc
ctgtcaactctaaattcatctggctctagcagagggaaagaaaggaaaagcaggaagtcc
atttttggcaacaatcctggcagaatgagccccggggagacagcgccatttaacagaaca
tctggaaaaggttcctgtgaagggatgcgacacacctgggaggaatcttctccactcagc
ccaagcacatccctcagcgctatcatcaggactcctaaatgctatcacatctcctcactg
aacgagaacgccgccaaacgtctgtgccgcaggggttctcagaaactgatccagcacacc
gcttatcagctgctgaggacctacccggcagcgaccagaatcgactcctccaatcccaac
cccatcatgttctggctccatgggatacagcttgtagctctaaactaccaaaccgatgac
cttcctttacatttaaacgccgccatgtttgaggcgaatggtgggtgtggttatgttttg
aagccccctgtcctgtgggataaaagctgtcccatgtaccagaagttttctccactggaa
agagacctagacaacctggatcctgctatctattctttaactatcatctctggccagaat
gtgtgccctagtaacagcaccggaagtccatgcattgaagtcgacgtcttgggcatgccc
ctggacagctgccatttccgcacaaaacccatccatcgaaacactctaaaccccatgtgg
aatgagcagtttctcttccgggttcactttgaagatcttgtatttcttcgttttgcagtc
gtggaaaacaacagttcggcgataacggctcagagaatcattccactcagagctttgaaa
cgaggatatcgacatcttcagctgcggaacctccacaatgaaatcttggaaatctctagc
ttattcataaacagcagaaggatggaagaaaacccctctggcagttccatgccagcctcg
ttgatgtttaatactgaagagaggaaatgttctcagactcacaaagtcacagtgcatggt
gtcccaggtccagagccctttgctgttttcactataaacgaaggcaccaaggcaaagcag
cttctccaacaggttttggcagttgaccaagacaccaaatgtactgccacagactatttt
ttgatggaagagaagcattttatatctaaggaaaagaatgaatgcaggaaacaaccattc
cagagagctgtgggtccagaagaagatattgtgcagattttaaacagttggttcccagaa
gaaggctacgtaggcaggattgtcttaaagccccaacaggaaactctagaagagaaaagc
attgtcttcgacgacaaagaggtgatcttgagctcagaggaggagagtttctttgtgcaa
gtgcatgatgtctctccagagcaacctcgaactgtcatcaaagccccacgtgtcagcact
gcacaggatgtaattcagcagaccttatgcaaagccaaatattcctacagcatcctgaac
aaccccaacccatgtgactatgtgcttttggaagaggtgctgaaagatgcagctaataag
aagtcttctaccccaaagtcctcgcagaggatcctcttggaccaagaatgtgtgtttcaa
gcgcaaagcaagtggaagggtgcgggaaagttcatacttaagctaaaggagcaggtgcag
gcatcccgagaagacaaaaggaggggtatctcctttgcaagtgaactcaagaagctcact
aagtccactaagcagtctcgagggctcccatcacctcctcagcttgtggcctcagaaagt
gttcaaagcaaggaggagaaacctgtgggtgccttgtcctctagtgacacagtgggttac
cagcagtga

DBGET integrated database retrieval system