KEGG   Mus musculus (mouse): 80908Help
Entry
80908             CDS       T01002                                 

Gene name
Abo, NAGAT
Definition
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase, transferase B, alpha 1-3-galactosyltransferase) (EC:2.4.1.37 2.4.1.40)
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    80908 (Abo)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     80908 (Abo)
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     80908 (Abo)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  ABO blood group
   80908 (Abo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 A3; 2
AA seq 287 aa AA seqDB search
MNLRGRPKCNFLHLGILPFAVFVLVFFGYLFLSFRSQNLGHPGAVTRNAYLQPRVLKPTY
VVFLKLFLETAEQHFMVGHKVIYYVFTDRPADVPQVILGAGRQLVVLTVRNYTRWQDVSM
HRMEMISHFSERRFLREVDYLVCADADMKFSDHVGVEILSTFFGTLHPGFYSSSREAFTY
ERRPQSQAYIPWDRGDFYYGGAFFGGSVLEVYHLTKACHEAMMEDKANGIEPVWHDESYL
NKYLLYHKPTKVLSPEYLWDQQLLGWPSIMKKLRYVAVPKDHQAIRN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcagaggaagaccgaaatgcaacttccttcaccttggaatccttcccttcgca
gtgtttgtcttagtcttctttggctacctgttcctaagcttcagaagccagaacttgggt
cacccaggagctgtgactaggaatgcctatctgcagccaagggtgctaaaacccacgtat
gtggtgttccttaagctgttccttgagactgcagaacaacacttcatggtgggacacaag
gtcatctactatgtcttcactgaccgtccagctgatgtgccacaggtgatcctgggtgca
ggacggcaactggtggtgctaactgtgcgcaactatactcgatggcaggatgtgtccatg
cacaggatggagatgatcagccacttctcagagcgacgctttctacgtgaggtggattac
ctggtgtgtgcagatgcggacatgaagttcagtgaccatgtgggtgtggagattctctca
acattctttggcactctgcaccctggcttctacagtagcagccgagaggcctttacctat
gagcgccggccacagtcccaggcctacatcccctgggacaggggtgacttttactacgga
ggagccttctttggggggtcagtgctagaagtgtaccatctcaccaaggcctgccatgaa
gctatgatggaggacaaggccaacggcattgagcctgtgtggcatgatgagagctatttg
aacaaatacctgctttaccataagcctacaaaggtgctgtccccagagtatttgtgggac
cagcagctgctgggctggccctccatcatgaagaagctgagatatgtggctgtgcccaag
gaccatcaggcaatcagaaactaa

DBGET integrated database retrieval system