KEGG   Mus musculus (mouse): 93687Help
Entry
93687             CDS       T01002                                 

Gene name
Csnk1a1, 2610208K14Rik, 4632404G05Rik, 5430427P18Rik, CK1a, Csnk1a
Definition
(RefSeq) casein kinase 1, alpha 1 (EC:2.7.11.1)
  KO
K08957  
casein kinase 1, alpha [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    93687 (Csnk1a1)
   04340 Hedgehog signaling pathway
    93687 (Csnk1a1)
 Human Diseases
  Cancers
   05224 Breast cancer
    93687 (Csnk1a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     93687 (Csnk1a1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CK1 group
  CK1 family [OT]
   93687 (Csnk1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18; 18 D3
AA seq 325 aa AA seqDB search
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaatttatcgtcggtggaaaatacaaactggtg
cggaagatcggatctggctctttcggggacatttatctagcgatcaacatcaccaatggc
gaggaagtggcagtgaaactagaatcccagaaggccaggcatccccagttgctgtacgag
agcaaactgtataagattcttcaaggtggggttggcatccctcacatacggtggtatggg
caagaaaaagactataatgtactagtcatggatctcctgggacccagccttgaagacctc
ttcaacttctgttcaaggaggttcactatgaagaccgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagttattccttattgattttggtttg
gccaaaaagtacagagacaacaggacaaggcaacacataccatacagagaagataaaaac
ctcactggcactgcccgatacgccagcatcaatgcacatcttggtattgagcagagtcgc
cgagatgacatggaatctttaggatatgttttgatgtattttaatagaaccagtctgccg
tggcaaggactgaaggctgcaacaaagaaacaaaaatatgaaaagattagtgaaaagaag
atgtccactcctgttgaggtgttgtgtaaggggtttcctgcagaatttgccatgtactta
aattactgtcgtgggctgcgctttgaggaagctccggattacatgtatctgaggcagcta
ttccgcatccttttcaggaccctgaaccaccaatatgactacacatttgattggacgatg
ttaaagcagaaagcagcccagcaggcagcctcttccagtgggcagggtcagcaggcccaa
acccccacaggtttctaa

DBGET integrated database retrieval system