KEGG   Mus musculus (mouse): 93687Help
Entry
93687             CDS       T01002                                 

Gene name
Csnk1a1, 2610208K14Rik, 4632404G05Rik, 5430427P18Rik, CK1a, Csnk1a
Definition
(RefSeq) casein kinase 1, alpha 1
  KO
K08957  
casein kinase 1, alpha [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Human papillomavirus infection
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    93687 (Csnk1a1)
   04340 Hedgehog signaling pathway
    93687 (Csnk1a1)
 Human Diseases
  Cancers
   05225 Hepatocellular carcinoma
    93687 (Csnk1a1)
   05226 Gastric cancer
    93687 (Csnk1a1)
   05224 Breast cancer
    93687 (Csnk1a1)
  Infectious diseases
   05165 Human papillomavirus infection
    93687 (Csnk1a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     93687 (Csnk1a1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CK1 group
  CK1 family [OT]
   93687 (Csnk1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18; 18 E1
AA seq 365 aa AA seqDB search
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaatttatcgtcggtggaaaatacaaactggtg
cggaagatcggatctggctctttcggggacatttatctagcgatcaacatcaccaatggc
gaggaagtggcagtgaaactagaatcccagaaggccaggcatccccagttgctgtacgag
agcaaactgtataagattcttcaaggtggggttggcatccctcacatacggtggtatggg
caagaaaaagactataatgtactagtcatggatctcctgggacccagccttgaagacctc
ttcaacttctgttcaaggaggttcactatgaagaccgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtccttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggacaaggcaacac
ataccatacagagaagataaaaacctcactggcactgcccgatacgccagcatcaatgca
catcttggtattgagcagagtcgccgagatgacatggaatctttaggatatgttttgatg
tattttaatagaaccagtctgccgtggcaaggactgaaggctgcaacaaagaaacaaaaa
tatgaaaagattagtgaaaagaagatgtccactcctgttgaggtgttgtgtaaggggttt
cctgcagaatttgccatgtacttaaattactgtcgtgggctgcgctttgaggaagctccg
gattacatgtatctgaggcagctattccgcatccttttcaggaccctgaaccaccaatat
gactacacatttgattggacgatgttaaagcagaaagcagcccagcaggcagcctcttcc
agtgggcagggtcagcaggcccaaacccccacaggcaagcaaactgacaaaaccaagagt
aacatgaaaggtttctaa

DBGET integrated database retrieval system