KEGG   Mus musculus (mouse): 93746Help
Entry
93746             CDS       T01002                                 

Gene name
Gprc5d
Definition
(RefSeq) G protein-coupled receptor, family C, group 5, member D
  KO
K04621  
G protein-coupled receptor family C group 5 member D
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class C. Metabotropic glutamate receptor family
  Other
   Orphan GPRC5
    93746 (Gprc5d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 G1
AA seq 344 aa AA seqDB search
MYEDCVKSTEDYYLFCDNEGPWAIVLESLAVIGIVVTILLLLAFLFLMRKVQDCSQWNVL
PTQFLFLLAVLGLFGLTFAFIIQLNHQTAPVRYFLFGVLFAICFSCLLAHASNLVKLVRG
RVSFCWTTILFIAIGVSLLQTIIAIEYVTLIMTRGLMFEHMTPYQLNVDFVCLLIYVLFL
MALTFFVSKATFCGPCENWKQHGRLIFATVLVSIIIWVVWISMLLRGNPQLQRQPHWDDA
VICIGLVTNAWVFLLIYIIPELSILYRSCRQECPTQGNVCQVPVYQRSFRMDTQEPTRAR
DSDGAQEDVALTAYGTPIQLQSADPSREYLIPSATLSPQQDAGL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaggactgcgtgaagtccacagaagactattacctcttctgtgacaacgagggg
ccatgggccattgttctggagtccttggcagtgattggcatagtggttaccatattgcta
ctcctggcatttctgttcctcatgcggaaggttcaggactgcagccagtggaacgtgctt
cccactcagttcctcttcctgctggctgtgctcgggctcttcggacttacttttgccttc
atcatccaactcaaccatcaaactgcccctgttcgctacttcctctttggggttctcttt
gctatctgcttctcctgcctcctggctcatgcctccaacctggtgaagctggtccggggt
agagtctccttctgctggacaacaattctgttcattgctatcggtgtcagcctgttgcag
accatcattgcgatagagtatgtgaccctcatcatgaccagaggcttgatgttcgagcat
atgacaccgtatcagctcaatgtggactttgtctgtctcctgatctatgtcctcttcctg
atggccctcactttcttcgtctccaaggccaccttctgtggcccatgtgagaactggaaa
cagcacggaaggctcatatttgctactgtgctggtctctatcattatctgggtggtgtgg
atctccatgctcttgagaggcaacccccagctccagcgacagccccactgggacgatgca
gtcatctgcattggcctggtcaccaacgcttgggtcttcctgctgatctacatcatccct
gagctgagcatactctacaggtcatgtaggcaggagtgtcctacacaaggcaacgtctgc
caggtccctgtctaccaacgcagcttcaggatggatacccaggaacccaccagagcccga
gacagtgatggagctcaggaggatgtagcactaactgcatatggtactcccattcagctg
cagagtgctgatcccagccgggagtatctcatcccatcagctacactaagcccacagcaa
gatgcaggattgtaa

DBGET integrated database retrieval system