KEGG   Mus musculus (mouse): 94192Help
Entry
94192             CDS       T01002                                 

Gene name
C1galt1, 2210410E06Rik, AV284120, T-synthase
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1 (EC:2.4.1.122)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
mmu  Mus musculus (mouse)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    94192 (C1galt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     94192 (C1galt1)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  Type 3 chain
   94192 (C1galt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 A1; 6
AA seq 363 aa AA seqDB search
MASKSWLNFLVFLCGSAIGFFLCSQLLSILLREEAAIQPNMLHNDPHARHSDDNGHSHLK
GQMNFNADSSQHKDENIDVAENLYQKVKILCWVMTSPQNLEKKAKHVKATWAQRCNKVLF
MSSEENQDFPTVGLKTKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVIVDNLR
WLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVNAFKTEKCTHSSSIED
LALGRCMEIINVEAGDSRDTIGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPIEGPGC
CSDIAVSFHYVDGTTMYELEYLVYHLRPYGYLYRYQPALPENILKEINQVNRKEDTKIKL
GNP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaattttttagtcttcctctgtggatcagcaatagggttt
tttttatgttctcaactcttgagtattttgttgcgagaagaggctgccattcagcctaac
atgcttcacaatgaccctcatgcaaggcattcagatgacaatggacacagtcacctcaaa
ggacagatgaacttcaatgcagattccagccaacataaagatgagaacatagacgttgct
gagaacctctatcagaaagttaaaattctttgttgggttatgacaagtcctcaaaatcta
gagaaaaaggccaaacatgtcaaagctacgtgggcccagcgttgtaataaagtgttattt
atgagttcggaagaaaatcaagacttccctactgtgggattgaaaaccaaagaaggcaga
gagcaactatattggaaaacaattaaagctttccagtatgtacatgaccattatttagaa
gatgctgactggtttatgaaagcagatgacgacacatacgtcattgtggacaacctgaga
tggcttctatcaaagtataaccctgaacaacccatttactttgggcgaagatttaagccc
tatgtgaagcagggatacatgagcggaggagcgggctatgtcctaagcaaggaagccttg
agaagatttgttaatgcatttaaaacagaaaagtgtacacatagttcctccatcgaagac
ttagctctgggaaggtgcatggaaattataaatgtagaagctggagattccagagatacc
attgggaaagaaaccttccatccatttgtaccagaacaccacttaatcaaaggttatcta
ccaaaaacattttggtactggaattacaactattatcctcccatagagggtcctggatgc
tgttctgatattgcagtttcttttcactatgttgatgggacaactatgtatgaattagaa
tacctcgtttatcatcttcgtccatatggttatttatatagatatcaacctgccttacct
gagaatatactgaaagaaattaatcaagtaaacagaaaggaagatacaaaaataaaatta
ggcaacccctga

DBGET integrated database retrieval system