KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0110Help
Entry
MSC_0110          CDS       T00161                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
mmy00040  Pentose and glucuronate interconversions
mmy00052  Galactose metabolism
mmy00500  Starch and sucrose metabolism
mmy00520  Amino sugar and nucleotide sugar metabolism
mmy01100  Metabolic pathways
mmy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MSC_0110 (galU)
   00052 Galactose metabolism
    MSC_0110 (galU)
   00500 Starch and sucrose metabolism
    MSC_0110 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MSC_0110 (galU)
Enzymes [BR:mmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MSC_0110 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Plasmod_Pvs28 IspD
Motif
Other DBs
NCBI-GeneID: 2744748
NCBI-ProteinID: NP_975120
UniProt: Q6MUC2
Position
complement(129970..130842)
Genome map
AA seq 290 aa AA seqDB search
MAIRKAVIPCAGFGTRFLPFTKSQAKEMLPIIDTPTIEYIVKEAVDSGIKEILIILNDKK
SEIMNYFSRNIQLEGFLYNKGKIAELEQIKTKYDASIHYIIQDEPLGLGHAISLCKGFIN
NESFAVLLGDDLFKCQTPAIKQLMDLYEEKQSTILGTILIDKKDCKKYGICKIESSDDNV
YKVCSVIEKPDEQNAPSNVAIAGRYILTPEIFNYLDLQLKGETGEIELTDSILKTISDVD
CYAKVIDGKRYDIGNKLGYLEAFVDFALNRDDTKNEFIKLVKKINEEETL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtggccattagaaaagctgttattccttgtgctggttttggaactagatttttacctttt
acaaaatcacaagcaaaagaaatgttacccattattgataccccaactatagaatatatt
gtaaaagaagctgttgatagtggtattaaagaaatattaataattttaaatgacaaaaaa
agtgaaataatgaattattttagtagaaacattcaacttgaaggttttttatataataaa
ggaaaaatcgctgaacttgaacaaattaaaactaaatatgatgcaagtattcactatata
atacaagatgaaccactaggtttaggacatgctatttctttgtgtaaaggttttataaat
aatgagtcttttgctgtgcttttaggagatgatttatttaaatgtcaaactcctgctatt
aaacaattaatggacttatatgaagaaaaacaatcaactattttagggacaattttaatt
gataaaaaagattgtaaaaagtatggaatttgtaagattgaatcaagtgatgataatgtt
tataaagtttgttctgtaattgaaaaaccagatgaacaaaacgctccaagtaatgttgcg
attgctggaagatacatattaactcctgaaatatttaactatttagacttacaacttaaa
ggtgaaactggagaaattgaattaactgattcaattttaaaaaccattagtgatgttgat
tgttatgcaaaagttattgatggaaaaagatatgatattggaaataaattaggttatcta
gaagcttttgttgattttgctttaaatagagatgatacaaaaaatgaatttataaaactt
gttaaaaaaataaatgaagaagaaactttataa

DBGET integrated database retrieval system