KEGG   Mesorhizobium opportunistum: Mesop_1239Help
Entry
Mesop_1239        CDS       T01542                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mop  Mesorhizobium opportunistum
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesop_1239
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mesop_1239
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Mesop_1239
Enzymes [BR:mop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mesop_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1288428..1289564
Genome map
AA seq 378 aa AA seqDB search
MQSLRKYRRITVKIGSALLVDRAAGLKRDWLASLADDIAVLADGGAEILVVSSGAIALGR
TILGLGKRALKLEESQAAAAVGQIALAGAWSDALGKGALKSGQILLTLGDTEERRRYLNA
RATISTLLKMKAVPVINENDTVATSEIRYGDNDRLAARVATMMGADLLVLLSDIDGLYTA
PPARDPQAKFIPVVDRITSDIEAMAGAAASELSRGGMRTKLDAGKIATAAGTAMIITSGT
RLSPLMAIERGERATFFRPSANPVKGYKTWIAGQLEPAGRLTVDAGAIGALLSGKSLLPA
GVKLVSGNFSRGDTVAILSPEGREIARGLVAYDAADAVRIAGLKTAEIETILGYEARSAM
IHRDDLVVNHAGDDTSGG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgctcaggaaataccggcgcatcaccgtcaagatcggctcggcgctgctcgtc
gatcgcgcggcgggtctcaagcgcgactggctggcctcgctcgccgacgatattgcggtg
ctggccgatggcggtgcggaaatcctcgtcgtgtcctccggcgccatcgcactcggccgc
accatcctcggcctcggcaagcgtgccctgaagctcgaggaaagccaggccgcggccgcc
gtcggacagatcgcgctcgccggcgcctggtcggatgcgctcggcaagggcgccctgaaa
tcaggccagattctcttgacccttggcgacacagaggaacgccgccgctatctcaacgcc
agggcgacgatctcgacattgctcaagatgaaggcggtgccggtcatcaacgagaacgac
acggtcgccacctccgaaatccgctatggcgacaatgaccggctggccgcgcgcgtcgcc
acgatgatgggcgccgacctcctggtgctgctctccgacattgacgggctctacaccgcg
ccgccggcgcgcgacccgcaagccaagttcatccccgtggtcgaccgcatcacatccgat
atcgaagccatggcgggagccgccgcttccgaactgtcgcgcggcggcatgcgcacgaag
ctcgatgccggcaagatcgccacggccgccggcacggcgatgatcatcacatcggggacg
cggctgtcgccgctgatggcgatcgagcgcggcgaacgcgccaccttcttccggccgagc
gccaatccggtcaagggctacaagacctggatcgccggccagctcgagccggccggccgg
ctgacggtcgatgccggcgccatcggcgcgctgctgtccggcaaatcgttgctgccggcc
ggcgtcaagctggtcagcggcaatttctcgcggggcgacaccgtggcgatcctgtcgcca
gagggccgcgagatcgcgcgcggactggttgcctacgatgccgccgatgccgtaaggatc
gctggcctgaagacagccgagatcgaaaccattctcggctacgaagcgcgttcggcgatg
atccaccgcgacgatttggtggtcaatcacgccggagacgacacaagcggaggatga

DBGET integrated database retrieval system