KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2304Help
Entry
DAMO_2304         CDS       T02155                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate 2,6-diaminopimelate ligase (UDP-N-acetylmuramyl-tripeptide synthetase) (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mox00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mox00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1979101..1980615)
Genome map
AA seq 504 aa AA seqDB search
MQLFDLINGTEHQVLRGSVDLEVHEIRYDSRQVKPGDLFVCIGGFRRDGHDFIQAAWAAG
AVAALVERTDLTEAALQGGTVVKVANTRQSLAAVACRFYGHPSRSLSMVGVTGTNGKTTT
TYLVESVLRCAGHQVGLIGTIGYRCNELELEAARTTPESCDLQALLERMARLRADSVVME
VSSHALALHRVDGCEFDVAVFTNLTQDHLDFHGTMEAYRSAKLSMFEGLGVGSTKTTEKA
AVVNLDDPAADLFLGATRVRRYSYSVEGPADLSVADVKMGPDGIRCRLQTPWGTTAIRSP
LLGRYNLSNILAAAATGLHLGADLSAVADGIAALHHVPGRCERVETGQAFSVMVDYAHTP
DALRRVLRMARQCCPGRLIVLFGCGGERDRGKRPLMGEAALELADFTVITSDNPRGEDPH
QIIEEIETGAKKVWGQGKGYVTILDRGMAIREALSLAGRGDMVVIAGKGHETYQILRDRT
IPFDDRLVAREALHELGFRRKDRV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttttcgacttaattaacggaaccgagcaccaggtcctccgcgggtccgtcgat
ctggaggttcatgagatccggtacgattccagacaggtaaagcccggcgatctgttcgta
tgtatcggagggttcaggcgggatggccacgactttattcaggccgcctgggcagcaggc
gctgttgcagccctggtagagcgaaccgatctgacggaggcggcgctgcagggcgggacg
gtggtgaaggtggcgaatacccggcaaagccttgctgccgttgcgtgtcggttctacggt
catccctcgcgcagtctctccatggtgggagtgaccgggaccaacggcaagaccaccacg
acctacctggtcgagtcggtgctacggtgcgcggggcatcaggtcggactgatcggcacg
atcgggtatcgctgtaacgagctggagctggaggcggcgcggaccacaccggaatcctgc
gatctgcaagcgctcctcgaacggatggcgcgtctgcgcgccgatagtgtggtcatggag
gtctcatcgcacgccctggctttgcatcgcgttgatggctgcgagtttgacgtggccgtg
ttcacgaacctgacgcaggaccatctggactttcatggcaccatggaggcgtatcggagc
gcaaagctgtccatgtttgagggattgggcgtagggtcaacaaaaacgacggagaaggcg
gcggtcgtcaatctggatgatccggccgcagatctctttcttggggcgacgcgggtgagg
cgttacagctacagcgtggagggaccggcggatctgtcggttgctgatgtcaagatgggg
ccggacggaatccggtgccggttgcagacgccgtgggggacgacggcgattcgctctccg
ctactgggacgctacaacctgtccaacatcctggcggctgccgctacagggttgcatctg
ggcgcggatttgtccgcggtggccgacgggatcgcagcgctccatcacgttccgggtcgg
tgtgagcgggtggagactgggcaggcgttcagtgtgatggttgattatgcgcataccccg
gacgcgctgcgacgtgtcctccgcatggcgcggcaatgctgtccaggacgcctgatcgtc
ctgtttggatgcggaggagagcgcgatcgggggaagcgtccgctcatgggagaagccgct
ctggaattggccgacttcacggtgatcacatccgataatcctcgtggtgaggaccctcat
cagatcattgaggagatcgaaaccggggcgaaaaaggtgtgggggcagggtaagggctat
gttacaattttagaccgagggatggcaattcgggaggccctctcgctggcgggtagaggt
gacatggtggtgatcgcggggaagggacacgagacctaccagattcttcgcgatcgaacg
atcccctttgatgatcgattggtggcgcgagaggcgcttcacgagttggggttccgccgt
aaagacagggtgtag

DBGET integrated database retrieval system