KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2625Help
Entry
DAMO_2625         CDS       T02155                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DAMO_2625 (galU)
   00052 Galactose metabolism
    DAMO_2625 (galU)
   00500 Starch and sucrose metabolism
    DAMO_2625 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    DAMO_2625 (galU)
Enzymes [BR:mox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     DAMO_2625 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2265091..2265996)
Genome map
AA seq 301 aa AA seqDB search
MRIRKAIVPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYVVEEAAASGIEDIIIVTGRGK
DAIENHFDRSLELQIALGRQGKAEQLREIEQISELASFCYIRQEEPLGLGHAILTAKALV
GNEPFAVLLGDDIIDAEVPCLAQMIAAFERYRSSIIAVQQVSREETGSYGIIDPRPAADS
IYQILDLVEKPTPEAAPSNLAIIGRYILTPEIFEALERTPPDEGGEIQLTNGLRVLLSTQ
TMYGLAFRGRRYDAGSKLGFVKATVQFALKRPDLAPGLREYLKTLSLDEVGAPVERDRHP
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattcgtaaagccattgtacccgccgccggtctggggacgcggttcctccctgca
acgaaggcgcagccgaaagagatgctgccgatcgtcgataagccgacgatccaatatgtg
gtggaggaagctgcggcgtccgggatcgaggatattatcattgtaaccgggcgggggaag
gatgcgattgagaaccattttgaccgatcgctcgagctgcaaattgcgcttgggcggcag
ggcaaggcggagcagttgcgggagatcgagcagatctccgagttggcgtcgttttgctac
atccgccaggaagagccgctcggattagggcacgcgattctgaccgcaaaggcgcttgtg
gggaatgagccttttgcggtcctgcttggcgacgatatcatcgatgccgaggtcccctgc
ttggcgcagatgattgcagcgtttgaacgatatcggtcctcgattattgctgtgcagcag
gtcagcagggaggaaaccggcagttacgggatcatcgatcccaggccggcagcggattcg
atctaccagatcctggatctggtagagaagccgactcccgaggcggctccgtccaaccta
gccatcatcgggcgttacatcctgacgccggaaatctttgaggcgcttgagcggactcct
ccggacgaaggcggagagattcagcttacgaatggtctgcgagtgctgttgagcacacaa
acgatgtatgggctcgcgttccgcgggcgccggtatgatgccgggagcaagctgggtttt
gtgaaggcgaccgtacagtttgcgctgaagcgtccggatctggcgccgggattgcgggag
tacctaaaaacactcagcctggatgaggtgggcgcgccggtagagcgggaccgacacccg
tcctga

DBGET integrated database retrieval system