KEGG   Mesotoga prima: Theba_0709Help
Entry
Theba_0709        CDS       T02123                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mpg  Mesotoga prima
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theba_0709
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theba_0709
   00052 Galactose metabolism
    Theba_0709
   00500 Starch and sucrose metabolism
    Theba_0709
   00520 Amino sugar and nucleotide sugar metabolism
    Theba_0709
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Theba_0709
   00524 Butirosin and neomycin biosynthesis
    Theba_0709
Enzymes [BR:mpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Theba_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
747693..748643
Genome map
AA seq 316 aa AA seqDB search
MVRRVIGIDLGGTETKIGIVEEDGKIVEKKVIPTRVSEGRTTVVTRIGEAINELLVQSGI
DSKQIIGIGVGSPGSIDHDTGTVLFSPNLPDWSGFGLAAMLERVTGIRTFVENDANSFIL
GEWAFGEFKGSQHMVGLTLGTGVGGGVITHGILMTGSKGYGGELGHTIVEPEGPVCGCGS
HGCLEALASATAIINLAREYSKRFPQSTIFASPEINAKVVFDAAREGDLAATLIVERATR
ALAIAIGNFIHVFNPEHIVIGGGISRAGDLLINGIREKLPAFVMTSFNGTFSITLSKLVE
NAGITGAASIVFYRTS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggtcagacgcgtaataggaattgatctgggtggaacagagacaaagatagggatagtt
gaggaagacggcaagatagtcgaaaaaaaggtgatccccacaagagtgtcagaaggtaga
actactgtcgtcacgagaattggtgaagcgataaatgagctccttgttcagtcgggtatc
gactcaaagcaaattatcggaatcggagttggttcacctggatcgatcgaccacgacacg
ggaactgtgctgttttctccaaatcttcccgattggtcggggttcgggctggcagctatg
ctcgagagagtcactggaataagaacatttgtagagaacgatgcaaattcctttattcta
ggagagtgggcattcggcgagttcaaaggcagccaacacatggtaggcctcacattaggt
accggagtcggagggggagtgataacccacggtattttgatgacaggtagcaaaggctat
ggaggggaacttggacacactatagttgaaccggaaggaccagtttgcggttgtggctct
cacggatgtcttgaagctcttgcttcggcgactgccataataaatctggccagggaatat
tcgaagagatttccgcagtcaacgatatttgcatcgcctgaaataaacgctaaagtggtc
tttgacgcggcacgggagggtgatctcgcagcaactctgatcgtagaaagagcaaccaga
gccctggctattgcaatcggaaatttcatacatgtgttcaatcccgaacatattgtcatt
ggcggtgggatcagcagagctggagatttgctaataaacgggataagggaaaaactcccg
gctttcgtaatgacttcttttaacgggaccttcagcatcactctgagcaaattggtagag
aatgcagggataacaggtgccgcgtcgatagtcttttacaggactagttga

DBGET integrated database retrieval system