KEGG   Moniliophthora perniciosa: MPER_14295Help
Entry
MPER_14295        CDS       T01089                                 

Definition
hypothetical protein
Orthology
K03946  
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
mpr  Moniliophthora perniciosa
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpr00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    MPER_14295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 30 aa AA seqDB search
KYPMIKEHNPDLPVLIREASGTPAIVFARF
NT seq 93 nt NT seq  +upstreamnt  +downstreamnt
ataagtatcctatgataaaggaacataatccagatttgcctgttctcattcgagaggcaa
gcggaacacctgctatagtattcgctagattcg

DBGET integrated database retrieval system