KEGG   Melissococcus plutonius ATCC 35311: MPTP_1081Help
Entry
MPTP_1081         CDS       T01492                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mps00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mps00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144306..1144812
Genome map
AA seq 168 aa AA seqDB search
MLSAIWAQDEQGTIGLNDKLPWHLPNDLKFFKQTTENNTLIMGRKTFEGMGKRSLPNRIT
IVLTHDQHYQVPDGVLVMHTINEVLDYAKNFSGITFITGGATVYKAFLPYCEVLYRTVIH
HTFKGDTQFPKVHWEEWTKINTSKGETDEKNNYSYEFETYQRKVYKNE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgctatcagcaatttgggcacaagatgaacaaggaaccattggattaaatgacaaactt
ccttggcatttacccaatgatttgaaattttttaagcaaaccactgaaaacaatacttta
attatgggaagaaaaacatttgaaggcatgggaaaacgatcattaccaaatcgaatcacg
attgttttaacccatgatcaacattatcaggtacctgatggtgttttggtgatgcatacg
atcaatgaagtattagactatgcaaagaatttttcaggtattacgtttattacgggtggg
gctactgtttataaagcttttttaccttattgtgaagtactttatcgcacagttattcac
catactttcaagggagatacacaatttccaaaagttcattgggaagaatggactaagatt
aatacaagtaaaggtgaaacggacgagaaaaataattattcctatgaatttgaaacctat
cagcgaaaagtctataaaaatgaataa

DBGET integrated database retrieval system