KEGG   Melissococcus plutonius ATCC 35311: MPTP_1081Help
Entry
MPTP_1081         CDS       T01492                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mps  Melissococcus plutonius ATCC 35311
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MPTP_1081
   00670 One carbon pool by folate
    MPTP_1081
Enzymes [BR:mps01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MPTP_1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144306..1144812
Genome map
AA seq 168 aa AA seqDB search
MLSAIWAQDEQGTIGLNDKLPWHLPNDLKFFKQTTENNTLIMGRKTFEGMGKRSLPNRIT
IVLTHDQHYQVPDGVLVMHTINEVLDYAKNFSGITFITGGATVYKAFLPYCEVLYRTVIH
HTFKGDTQFPKVHWEEWTKINTSKGETDEKNNYSYEFETYQRKVYKNE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgctatcagcaatttgggcacaagatgaacaaggaaccattggattaaatgacaaactt
ccttggcatttacccaatgatttgaaattttttaagcaaaccactgaaaacaatacttta
attatgggaagaaaaacatttgaaggcatgggaaaacgatcattaccaaatcgaatcacg
attgttttaacccatgatcaacattatcaggtacctgatggtgttttggtgatgcatacg
atcaatgaagtattagactatgcaaagaatttttcaggtattacgtttattacgggtggg
gctactgtttataaagcttttttaccttattgtgaagtactttatcgcacagttattcac
catactttcaagggagatacacaatttccaaaagttcattgggaagaatggactaagatt
aatacaagtaaaggtgaaacggacgagaaaaataattattcctatgaatttgaaacctat
cagcgaaaagtctataaaaatgaataa

DBGET integrated database retrieval system