KEGG   Meiothermus ruber DSM 1279: Mrub_1511Help
Entry
Mrub_1511         CDS       T01193                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00260  Glycine, serine and threonine metabolism
mrb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
mrb01130  Biosynthesis of antibiotics
mrb01230  Biosynthesis of amino acids
Module
mrb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrub_1511
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mrub_1511
Enzymes [BR:mrb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mrub_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP THUMP
Motif
Other DBs
NCBI-ProteinID: ADD28273
UniProt: D3PS40
Position
1543083..1544303
Genome map
AA seq 406 aa AA seqDB search
MQLPSYPLPDPRGRYGEFGGRYVPETLIPALEELTEAYLHYKQDPEFLAEYAYYLREYVG
RPSPLYFAENLTRHLGGAKIYLKREDLNHTGAHKINNTLGQALLCKRMGKKRVIAETGAG
QHGVSVATVAALMGLECVVYQGAEDVRRQALNVFRMRLLGAEVRPVESGTRTLKDATNEA
IRDWVTNVRDSFYIIGSVVGPHPYPAMARDFQSVVGEEIKAQLLEKEGRENPDVILACVG
GGSNAIGVFAPFAYQENRPRLIGVEAAGHGKASGLHSLSIGAGRKGVLHGAKMYLLYDDD
GQILPAHSVSAGLDYPGVGPEHSYYAEQGLAEYVGISDEEALEGFQLLCRLEGIIPALES
AHAIAYAAKLAPELEPEQIMVINLSGRGDKDVVEVMRLMEARGGAA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcagctacccagctaccctttacccgacccccggggccgctacggcgagtttggcggg
cgctatgtgcccgagaccctgattccggccctggaggagctcaccgaggcctacctgcac
tacaagcaagaccccgagttcctggccgagtacgcctactacctgcgcgagtacgtgggc
cggcccagccccctctactttgccgagaacctgacccggcacctgggcggggccaagatc
tacctcaagcgcgaagacctgaaccacaccggggcccacaagatcaacaacaccctgggc
caggccctgctgtgcaagcgcatgggcaagaagcgggtgatcgccgagaccggcgcgggc
cagcacggcgtctcggtggccacggtggcggccctgatgggcctggagtgcgtggtgtac
cagggggccgaggacgtgcggcggcaggccctgaacgtctttcgcatgaggctcctgggg
gccgaggtacgccccgtggagagcggaacccgcaccctcaaggacgccaccaacgaggcc
atccgcgactgggtgaccaacgtgcgcgacagcttttacatcatcggctcggtggtgggg
ccgcacccctacccggccatggcccgcgactttcagagcgtggtgggcgaggaaattaaa
gcccagctcctcgagaaagagggccgcgagaacccggatgtgatcctggcctgcgtgggt
gggggttccaacgccattggggtgtttgcgccttttgcctaccaggagaaccggccccgg
ctgattggggtggaggccgctggccacggcaaagcctcgggcctgcacagcctgagcatc
ggggcgggccggaagggggtgctgcacggggccaagatgtacctgctctacgacgacgac
ggccagattctgccggctcactcggtctcggcaggcctcgattaccccggtgtgggcccc
gagcacagctactacgccgagcaggggctggccgagtacgtgggcatcagcgacgaggag
gccctcgagggcttccagttgctgtgccgcctggaagggattatcccggccctggagtcg
gcccacgccatcgcctacgcggccaagctggccccggagctggaacccgagcagatcatg
gttatcaacctctcgggccggggcgacaaggacgtggtggaggtgatgcggctgatggag
gccagaggaggggcggcatga

DBGET integrated database retrieval system