KEGG   Meiothermus ruber DSM 1279: Mrub_1511Help
Entry
Mrub_1511         CDS       T01193                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mrub_1511
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrub_1511
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mrub_1511
Enzymes [BR:mrb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mrub_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1543083..1544303
Genome map
AA seq 406 aa AA seqDB search
MQLPSYPLPDPRGRYGEFGGRYVPETLIPALEELTEAYLHYKQDPEFLAEYAYYLREYVG
RPSPLYFAENLTRHLGGAKIYLKREDLNHTGAHKINNTLGQALLCKRMGKKRVIAETGAG
QHGVSVATVAALMGLECVVYQGAEDVRRQALNVFRMRLLGAEVRPVESGTRTLKDATNEA
IRDWVTNVRDSFYIIGSVVGPHPYPAMARDFQSVVGEEIKAQLLEKEGRENPDVILACVG
GGSNAIGVFAPFAYQENRPRLIGVEAAGHGKASGLHSLSIGAGRKGVLHGAKMYLLYDDD
GQILPAHSVSAGLDYPGVGPEHSYYAEQGLAEYVGISDEEALEGFQLLCRLEGIIPALES
AHAIAYAAKLAPELEPEQIMVINLSGRGDKDVVEVMRLMEARGGAA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcagctacccagctaccctttacccgacccccggggccgctacggcgagtttggcggg
cgctatgtgcccgagaccctgattccggccctggaggagctcaccgaggcctacctgcac
tacaagcaagaccccgagttcctggccgagtacgcctactacctgcgcgagtacgtgggc
cggcccagccccctctactttgccgagaacctgacccggcacctgggcggggccaagatc
tacctcaagcgcgaagacctgaaccacaccggggcccacaagatcaacaacaccctgggc
caggccctgctgtgcaagcgcatgggcaagaagcgggtgatcgccgagaccggcgcgggc
cagcacggcgtctcggtggccacggtggcggccctgatgggcctggagtgcgtggtgtac
cagggggccgaggacgtgcggcggcaggccctgaacgtctttcgcatgaggctcctgggg
gccgaggtacgccccgtggagagcggaacccgcaccctcaaggacgccaccaacgaggcc
atccgcgactgggtgaccaacgtgcgcgacagcttttacatcatcggctcggtggtgggg
ccgcacccctacccggccatggcccgcgactttcagagcgtggtgggcgaggaaattaaa
gcccagctcctcgagaaagagggccgcgagaacccggatgtgatcctggcctgcgtgggt
gggggttccaacgccattggggtgtttgcgccttttgcctaccaggagaaccggccccgg
ctgattggggtggaggccgctggccacggcaaagcctcgggcctgcacagcctgagcatc
ggggcgggccggaagggggtgctgcacggggccaagatgtacctgctctacgacgacgac
ggccagattctgccggctcactcggtctcggcaggcctcgattaccccggtgtgggcccc
gagcacagctactacgccgagcaggggctggccgagtacgtgggcatcagcgacgaggag
gccctcgagggcttccagttgctgtgccgcctggaagggattatcccggccctggagtcg
gcccacgccatcgcctacgcggccaagctggccccggagctggaacccgagcagatcatg
gttatcaacctctcgggccggggcgacaaggacgtggtggaggtgatgcggctgatggag
gccagaggaggggcggcatga

DBGET integrated database retrieval system