KEGG   Methylobacterium radiotolerans: Mrad2831_1597Help
Entry
Mrad2831_1597     CDS       T00674                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mrad2831_1597
Enzymes [BR:mrd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mrad2831_1597
Exosome [BR:mrd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mrad2831_1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1690708..1692990)
Genome map
AA seq 760 aa AA seqDB search
MTAIDETFATRVDPEGATARSADVPGSGAAQPPSVHPDAIAALMAANHGDPFAVLGPHRV
GPRAWEVRAVLPEARAATLVMDGRTAPFEKRHPDGFWVARVEGEHRPLYEIEVESWDGAK
RRRYDPYGFGSSIEQYDVAALREVGTNLVYRMLGAQSGQLDGIDGFRFAVWAPNARKVSV
VGDFNDWDGRRHPMRLWQDGGIWELFVPGLKAGVRYKFEIRGPDGSLVPLKADPVAFAAQ
HPPETASVTHGSGDFDWRDSGWMSTRGAKDPRHAAISVYEVHLGSWARVPEEGNRYLTYR
ELAERLIPYVKDLGFTHIEMLPITEFPFDGSWGYQPVSLFAPTSRFGTPEDFAAFVDAAH
AAGIGVLLDWVPGHFPLDAHGLGLFDGTHLYEHADPRQGFHQDWGTYIYNFGRTEVATFL
AANARFWLEHYHLDGLRVDAVASMLYLDYSRRQGEWIPNRYGGNENLDAIDFLRKTNEAT
YSHAPGTITVAEESTSWPGVSHPTYTGGLGFGFKWNMGWMHDTLHFMQEDPIHRRYHHHN
LTFGLLYAFSENFILPLSHDEVVHGKGSLLGKMPGDRWQKFANLRAYYGFMWGHPGKKLL
FMGGEFGQEREWNHDNSLDWHLLEDPLHKGVQSVIRDLNRLYVSTPALYSRDVEHTGFQW
LVADDQDNSVIAWARKGAQSGEVAIVVSNFTPVPREGYRIGVPQAGFYREAFNSDAGVYG
GSNLGNQGGRHTDDQASHGQKQSLSLTLPPLATMIFLLEG
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgatcgacgagaccttcgcaacgcgggtcgacccggagggggcgacggcgcgg
tccgcggatgtcccgggctccggcgccgcgcagccgccgagcgtccacccggacgcgatc
gccgcgctgatggcggccaatcacggcgaccccttcgcggtgctcggcccccaccgcgtc
gggcccagggcctgggaggtgcgcgccgtgctgcccgaggcgcgggccgccaccctggtc
atggacggccgcaccgcgccgttcgagaagcgccatccggacgggttctgggtcgcccgg
gtcgagggcgagcaccggccgctctacgagatcgaggtcgagtcctgggacggcgccaag
cgccgccgctacgatccctacggcttcggctcctcgatcgagcagtacgacgtggcggcg
ctccgcgaggtcggcaccaacctcgtctaccggatgctcggcgcccagtcgggtcagctc
gacggcatcgacggtttccgcttcgccgtctgggcgcccaacgcccgcaaggtcagcgtc
gtcggcgacttcaacgactgggacgggcggcgccacccgatgcgcctctggcaggacggc
ggcatctgggagctgttcgtgccgggcctcaaggccggggtccgctacaagttcgagatc
cgcggccccgacgggtccctggtgcccctcaaggccgacccggtcgccttcgcggcccag
cacccgccggagaccgcctcggtcacccacgggtcgggcgacttcgactggcgcgattcc
ggctggatgagcacccgcggcgccaaggacccgcgccacgcggcgatctcggtctacgag
gtccatctcggttcctgggcgcgggtgcccgaggaggggaaccgctacctgacctaccgg
gagctcgccgagcggctgatcccctacgtgaaggatctgggcttcacccatatcgagatg
ctgccgatcaccgagttcccgttcgacgggtcctggggctaccagccggtctcgctgttc
gcgccgacgagccgcttcggcacgcccgaggatttcgcggccttcgtggacgcggcccac
gcggccggcatcggcgtgctgctcgactgggtgccgggccacttccccctcgacgcccac
gggctcggcctgttcgacggcacgcacctctacgagcacgccgacccgcgccagggcttc
caccaggactggggcacctacatctacaatttcgggcgcaccgaggtcgcgacgttcctc
gccgccaacgcccggttctggctggagcactaccacctcgacggcctgcgcgtggacgcc
gtcgcgtcgatgctctacctcgactactcgcgccgccagggcgagtggatcccgaaccgc
tacggcggcaacgagaacctcgacgccatcgacttcctgcgcaagaccaacgaggcgacc
tacagccacgccccggggacgatcacggtcgcggaggaatcgacctcctggccgggcgtc
tcgcacccgacctacacgggcggcctgggcttcggcttcaagtggaacatgggctggatg
cacgacaccctgcatttcatgcaggaggatccgatccaccgccgctaccaccaccacaac
ctgaccttcgggctgctctacgccttctcggagaatttcatcctgccgctgtcccacgac
gaggtcgtgcacgggaagggctcgctgctcggcaagatgccgggcgaccgctggcagaaa
ttcgcgaatctccgggcctattacggcttcatgtgggggcatcccggcaagaagctgctg
ttcatgggcggcgagttcggccaggagcgggagtggaaccacgacaacagcctggactgg
cacctgctggaggatcccctgcacaagggcgtccagagcgtgatccgcgacctgaaccgg
ctctacgtgtcgacgccggccctctacagccgcgacgtcgagcacaccggcttccagtgg
ctggtggccgacgaccaggacaacagcgtcatcgcctgggcccgcaagggcgcgcagtcc
ggcgaggttgccatcgtggtgtcgaacttcacgccggtgccgcgggagggctaccggatc
ggcgtgccgcaggcgggcttctaccgcgaggcgttcaactcggatgccggggtctacggt
ggctccaacctgggcaaccagggtgggcgccataccgacgatcaggcgagccacggccag
aagcagagcctgtcgctgaccctgccgccgctggcgacgatgatcttcctgctggagggg
tga

DBGET integrated database retrieval system