KEGG   Mycobacterium rhodesiae: MycrhN_6171Help
Entry
MycrhN_6171       CDS       T01685                                 

Definition
(RefSeq) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MycrhN_6171
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MycrhN_6171
   00650 Butanoate metabolism
    MycrhN_6171
  Lipid metabolism
   00071 Fatty acid degradation
    MycrhN_6171
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MycrhN_6171
   00310 Lysine degradation
    MycrhN_6171
   00360 Phenylalanine metabolism
    MycrhN_6171
   00380 Tryptophan metabolism
    MycrhN_6171
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MycrhN_6171
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MycrhN_6171
   00281 Geraniol degradation
    MycrhN_6171
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MycrhN_6171
   00627 Aminobenzoate degradation
    MycrhN_6171
   00930 Caprolactam degradation
    MycrhN_6171
Enzymes [BR:mrh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MycrhN_6171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6245212..6246120
Genome map
AA seq 302 aa AA seqDB search
MSDYRFLKWETFDDGMIVRISLNRPEQRNAQNRGMLVELDEAFGRAEADDKVRVVILAGE
GKMFSSGHDIGSKQASAEFRPGPDQHPTAAINGGTREGAEKIMLQEWHYFFQNTLRWRNL
RKITIAQVHGDVFSAGLMLMWACDLIVGSEEVRFADVVGTRLGMCGMEYFGHPWEFGPRK
AKELMLTGDAIDIHEAHRLGMVSKVFPRDELADRTLDMARRIGEVPTMAALLIKESVNQT
VDNMGFYNSLQSCFTLHQLNHSHWVGVRDDRRAVAGPENGVPDWRTAPPIVLSVKDQVRV
ES
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgactacagattcctcaaatgggagacgttcgacgacggcatgatcgtgcgcatc
tcgttgaaccggcccgaacagcggaatgcccagaaccgcggcatgctcgtcgaactcgac
gaagcgttcggccgcgcggaagccgacgacaaggtacgcgtggtgatccttgccggcgag
ggcaagatgttctcgtcgggtcacgacatcggttcgaagcaggccagcgcggagtttcgg
ccaggccccgatcagcacccgacggcggcgatcaacggcggcacccgggagggcgccgag
aaaatcatgctgcaggagtggcactacttcttccagaacacgttgcgatggcgcaaccta
cgcaagatcaccatcgcgcaggtccacggtgatgtgttctcggcggggctgatgctgatg
tgggcgtgcgacctcattgtcggcagcgaagaggtgcgcttcgccgacgtcgtcggcacc
cgactcggtatgtgcggcatggagtacttcggccacccgtgggagttcgggccgcgaaaa
gccaaagaactcatgctcaccggcgacgccatcgacatccacgaggctcatcggctcggg
atggtgagcaaggtgttcccgcgcgacgaattggccgatcgcacactcgatatggcccgt
cgtatcggcgaggtacccaccatggcagcgctgttgatcaaggagtccgtcaaccagacc
gtcgacaacatgggcttttacaactcgctgcagtcgtgcttcaccctgcaccagctcaac
cattcgcactgggtgggcgtccgcgacgacaggcgcgccgtagccggcccggagaacggt
gtgcccgactggcggaccgcgcccccgatcgtcctctcggtcaaggaccaggtcagagtg
gagtcatga

DBGET integrated database retrieval system