KEGG   Melioribacter roseus: MROS_2201Help
Entry
MROS_2201         CDS       T02176                                 

Definition
4-Alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mro  Melioribacter roseus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mro00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MROS_2201
Enzymes [BR:mro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MROS_2201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2574209..2575717
Genome map
AA seq 502 aa AA seqDB search
MTFTRSAGILLHPTSLPGNYGIGDLGKEAYKFIDFLAETGNTLWQALPLGPTGFGNSPYQ
CFSAFAGNPLLISPEILKDEGLLNDDDLKSLITHEKHHVDFGKIIGLKFDALRKAYANYN
LSGKDGFEEFCESNRDWLDDFALFMACKNYHGGIVWSQWEEEIAFRKGDAVEKWTKKLSD
EIRFQKFIQFKFFSQWKNLRDYANSKGIKIIGDVPIYIAYDSADLWANKKYFTVDEKGKL
EFVAGVPPDYFSATGQLWGNPLYKWDVIEKDNFRWWIDRFRSILNLVDIVRIDHFRGFEA
YYKIPGDAPTAETGEWVKAPGEKLFNTLKNEFGELPVLAEDLGIITKEVEELRDKFEFPG
MKILQFAFGKDGEKRFLPHNFINNCVVYTGSHDNDTTRGFFEKEKEKNSDVYYHARDYMN
YYGDDMCHALIKLAYSSVGNIVIIPMQDILNLDSSARMNFPSKPDGNWTWRFSWEQAPEG
LVKHYKYLIELYERNPNEVNHD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacatttacgcgttctgcgggtatactgcttcaccccacatctttgccgggaaattac
ggcataggcgatctcggcaaagaagcttacaaatttatagactttcttgcggaaaccggc
aatacgctctggcaggcgctgccgttgggtcctacgggattcggcaattcgccttatcaa
tgtttctcggcttttgcaggaaatcctttgcttataagtcccgaaattctgaaagacgaa
ggcttattgaacgacgatgatctgaaaagtttgattactcacgaaaagcatcacgtcgat
ttcggaaaaataatcggtttgaaatttgacgcgctgagaaaagcgtacgcaaattataat
ttatccgggaaagacggtttcgaagagttctgcgaatcgaacagggattggctcgatgat
tttgcgctttttatggcctgcaaaaattatcacggcggaattgtctggagccaatgggaa
gaagaaattgcattcagaaaaggagacgcagtcgaaaaatggacgaaaaaactgagcgac
gaaataagattccagaaattcattcagtttaagtttttcagtcaatggaaaaatttaaga
gactatgccaattcgaaagggataaaaattatcggcgacgtgccgatctatattgcatac
gacagcgcggacttatgggctaataaaaaatattttaccgtcgatgaaaaaggcaaactg
gaattcgttgcgggagtgccgccggattatttcagcgccacaggacaattatggggaaat
cctttatacaaatgggacgtaattgaaaaagataatttcaggtggtggattgaccgtttc
agatcgatcctcaatttggtagacatagtacgcatagaccacttcagaggattcgaagcc
tattataaaattccgggcgacgcgcctaccgccgaaacaggcgagtgggttaaagctccg
ggagaaaaattattcaatactttgaaaaacgaattcggagaattgcccgtactggctgaa
gacctcggaattataaccaaagaagttgaagaactgagggataaattcgaattccccgga
atgaaaattctccagttcgcattcggtaaagacggcgaaaagagatttctaccgcacaat
tttataaataactgcgtggtttatacgggttcgcatgacaacgatacaacccgcggcttt
ttcgaaaaagaaaaagagaaaaattccgacgtctattatcacgcccgcgattacatgaat
tattacggcgacgatatgtgtcacgcccttattaaacttgcttattcgtccgtcggcaat
atcgttataattccgatgcaggatattctgaatctcgacagctccgccagaatgaatttc
ccgagcaaacccgacggaaactggacgtggcgattcagctgggagcaggcgcccgaagga
ttggtcaaacattataaatatttgatagaattgtacgaaagaaatccgaacgaagtaaat
catgattaa

DBGET integrated database retrieval system